Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004947000
  • symbol?: nos
  • description?: nitric-oxide synthase-like protein

      descriptions from strain specific annotations:

    • nitric-oxide synthase-like protein
    • nitric-oxide synthase, oxygenase subunit
    • nitric oxide synthase oxygenase
    • nitric oxide synthase oxygenase subunit
    • putative oxygenase
    • nitric oxide synthase, oxygenase domain protein
  • strand?: +
  • coordinates?: 5136382..5137467
  • synteny block?: BlockID0038510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1871
    08BA02176:
    C248_1990
    11819-97:
    MS7_1949 (nos)
    71193:
    ST398NM01_2009
    ECT-R 2:
    ECTR2_1786
    ED133:
    SAOV_2017
    ED98:
    SAAV_1981
    HO 5096 0412:
    SAEMRSA15_18240
    JH1:
    SaurJH1_2004
    JH9:
    SaurJH9_1970
    JKD6008:
    SAA6008_01935
    JKD6159:
    SAA6159_01846
    LGA251:
    SARLGA251_17990
    M013:
    M013TW_1951
    MRSA252:
    SAR2007
    MSHR1132:
    SAMSHR1132_17590
    MSSA476:
    SAS1838
    Mu3:
    SAHV_1899
    Mu50:
    SAV1914
    MW2:
    MW1855
    RF122:
    SAB1851
    ST398:
    SAPIG2009
    T0131:
    SAT0131_02042 (sdaAB)
    TCH60:
    HMPREF0772_11227 (nos)
    TW20:
    SATW20_19090
    USA300_TCH1516:
    USA300HOU_1916
    VC40:
    SAVC_08835

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
    N315            MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
    NCTC8325        MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
    Newman          MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
    USA300_FPR3757  MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
                    ************************************************************

    COL             RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
    N315            RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
    NCTC8325        RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
    Newman          RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
    USA300_FPR3757  RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
                    ************************************************************

    COL             QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
    N315            QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
    NCTC8325        QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
    Newman          QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
    USA300_FPR3757  QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
                    ************************************************************

    COL             EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
    N315            EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
    NCTC8325        EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
    Newman          EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
    USA300_FPR3757  EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
                    ************************************************************

    COL             RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
    N315            RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
    NCTC8325        RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
    Newman          RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
    USA300_FPR3757  RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
                    ************************************************************

    COL             RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
    N315            RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
    NCTC8325        RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
    Newman          RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
    USA300_FPR3757  RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
                    **********************************************************