From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004973000
  • symbol?:
  • description?: choloylglycine hydrolase

      descriptions from strain specific annotations:

    • choloylglycine hydrolase
    • acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase family protein
    • C40 family peptidase
    • Choloylglycine hydrolase:Peptidase C45, acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase
    • linear amide C-N hydrolase, choloylglycine hydrolase family protein
  • strand?: +
  • coordinates?: 5160842..5161955
  • synteny block?: BlockID0038710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1883
    08BA02176:
    C248_2012
    11819-97:
    MS7_1960
    71193:
    ST398NM01_2028
    ECT-R 2:
    ECTR2_1797
    ED133:
    SAOV_2027
    ED98:
    SAAV_1992
    HO 5096 0412:
    SAEMRSA15_18410
    JH1:
    SaurJH1_2015
    JH9:
    SaurJH9_1982
    JKD6008:
    SAA6008_01946
    JKD6159:
    SAA6159_01856
    LGA251:
    SARLGA251_18090
    M013:
    M013TW_1962
    MRSA252:
    SAR2017
    MSHR1132:
    SAMSHR1132_17690
    MSSA476:
    SAS1849
    Mu3:
    SAHV_1910
    Mu50:
    SAV1925
    MW2:
    MW1866
    RF122:
    SAB1861
    ST398:
    SAPIG2028
    T0131:
    SAT0131_02055 (ptsG)
    TCH60:
    HMPREF0772_11216
    TW20:
    SATW20_19190
    USA300_TCH1516:
    USA300HOU_1928
    VC40:
    SAVC_08885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQQVTSDIMTFRGSHFELGVKTGKWLQQTPLLKNREKEWKKRVPRFDIDVNETYQIFQTY
    N315            MQQVISDIMTFRGSHFELGVKTGKWLQQTPLLKNREKEWKKRVPRFDIDVNETYQIFQTY
    NCTC8325        MQQVTSDIMTFRGSHFELGVKTGKWLQQTPLLKNREKEWKKRVPRFDIDVNETYQIFQTY
    Newman          MQQVTSDIMTFRGSHFELGVKTGKWLQQTPLLKNREKEWKKRVPRFDIDVNETYQIFQTY
    USA300_FPR3757  MQQVTSDIMTFRGSHFELGVKTGKWLQQTPLLKNREKEWKKRVPRFDIDVNETYQIFQTY
                    **** *******************************************************

    COL             APQIWEELMGLQSILKMPTRQIILNFGHYRFTDLKESGCTVFQGKDFMVRNYDYHPATYD
    N315            APQIWEELMGLQSILKMPTRQIILNFGHYRFTDLKESGCTVFQGKDFMVRNYDYHPATYD
    NCTC8325        APQIWEELMGLQSILKMPTRQIILNFGHYRFTDLKESGCTVFQGKDFMVRNYDYHPATYD
    Newman          APQIWEELMGLQSILKMPTRQIILNFGHYRFTDLKESGCTVFQGKDFMVRNYDYHPATYD
    USA300_FPR3757  APQIWEELMGLQSILKMPTRQIILNFGHYRFTDLKESGCTVFQGKDFMVRNYDYHPATYD
                    ************************************************************

    COL             GRYLLYQPTDSGLAQIGPVSRVTGRMDGMNESGLTMGYNFMHRKKPANGFVCYMIGRLIL
    N315            GRYLLYQPTDSGLAQIGPVSRVTGRMDGMNESGLTMGYNFMHRKKPANGFVCYMIGRLIL
    NCTC8325        GRYLLYQPTDSGLAQIGPVSRVTGRMDGMNESGLTMGYNFMHRKKPANGFVCYMIGRLIL
    Newman          GRYLLYQPTDSGLAQIGPVSRVTGRMDGMNESGLTMGYNFMHRKKPANGFVCYMIGRLIL
    USA300_FPR3757  GRYLLYQPTDSGLAQIGPVSRVTGRMDGMNESGLTMGYNFMHRKKPANGFVCYMIGRLIL
                    ************************************************************

    COL             ENCRNVTEAIQLLKEIPHRSSFSYILMDKSLNHAIVEVTPRSIDVRYDNICTNHFEILTH
    N315            ENCRNVTEAIQLLKEIPHRSSFSYILMDKSLNHAIVEVTPRSIDVRYDNICTNHFEILTH
    NCTC8325        ENCRNVTEAIQLLKEIPHRSSFSYILMDKSLNHAIVEVTPRSIDVRYDNICTNHFEILTH
    Newman          ENCRNVTEAIQLLKEIPHRSSFSYILMDKSLNHAIVEVTPRSIDVRYDNICTNHFEILTH
    USA300_FPR3757  ENCRNVTEAIQLLKEIPHRSSFSYILMDKSLNHAIVEVTPRSIDVRYDNICTNHFEILTH
                    ************************************************************

    COL             ENRNYTKESKERLARTISQTNDNLDMTTAFKLFNNPQYEIYSKLFKSWSGTIHTSMYQPE
    N315            ENRNYTKESKERLARTISQTNDNLDMTTAFKLFNNPQYEIYSKLFKSWSGTIHTSMYQPE
    NCTC8325        ENRNYTKESKERLARTISQTNDNLDMTTAFKLFNNPQYEIYSKLFKSWSGTIHTSMYQPE
    Newman          ENRNYTKESKERLARTISQTNDNLDMTTAFKLFNNPQYEIYSKLFKSWSGTIHTSMYQPE
    USA300_FPR3757  ENRNYTKESKERLARTISQTNDNLDMTTAFKLFNNPQYEIYSKLFKSWSGTIHTSMYQPE
                    ************************************************************

    COL             TLTAYFTLGENAPPEIIDFKSWLDGQDLNITHFTGNIDTDLTFANK
    N315            TLTAYFTLGENAPPEIIDFKSWLDGQDLNITHFTGNIDTDLTFANK
    NCTC8325        TLTAYFTLGENAPPEIIDFKSWLDGQDLNITHFTGNIDTDLTFANK
    Newman          TLTAYFTLGENAPPEIIDFKSWLDGQDLNITHFTGNIDTDLTFANK
    USA300_FPR3757  TLTAYFTLGENAPPEIIDFKSWLDGQDLNITHFTGNIDTDLTFANK
                    **********************************************