From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004994000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 5176910..5177395
  • synteny block?: BlockID0038750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1886
    08BA02176:
    C248_2015
    11819-97:
    MS7_1963
    71193:
    ST398NM01_2049
    ECT-R 2:
    ECTR2_1800
    ED133:
    SAOV_2030
    ED98:
    SAAV_1995
    HO 5096 0412:
    SAEMRSA15_18440
    JH1:
    SaurJH1_2018
    JH9:
    SaurJH9_1985
    JKD6008:
    SAA6008_01949
    JKD6159:
    SAA6159_01859
    LGA251:
    SARLGA251_18120
    M013:
    M013TW_1965
    MRSA252:
    SAR2020
    MSHR1132:
    SAMSHR1132_17720
    MSSA476:
    SAS1852
    Mu3:
    SAHV_1913
    Mu50:
    SAV1928
    MW2:
    MW1869
    RF122:
    SAB1864c
    ST398:
    SAPIG2049
    T0131:
    SAT0131_02058
    TCH60:
    HMPREF0772_11213
    TW20:
    SATW20_19220
    USA300_TCH1516:
    USA300HOU_1931
    VC40:
    SAVC_08900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLYLNKYKERVTSVRIQNRWVVFILFLICSFGVLIGLYQYRHTKTVDLSNLEINDIKLNE
    N315            MLYLNKYKERVTSVRIQNRWVVFILFLICSFGVLIGLYQYRHTKTVDLSNLEINDIKLNE
    NCTC8325        MLYLNKYKERVTSVRIQNRWVVFILFLICSFGVLIGLYQYRHTKTVDLSNLEINDIKLNE
    Newman          MLYLNKYKERVTSVRIQNRWVVFILFLICSFGVLIGLYQYRHTKTVDLSNLEINDIKLNE
    USA300_FPR3757  MLYLNKYKERVTSVRIQNRWVVFILFLICSFGVLIGLYQYRHTKTVDLSNLEINDIKLNE
                    ************************************************************

    COL             KFDKKGYEVNKKIKFDRFKFYNSKAHPDLTVKVREKDNIVKGIILVRDEKIHTNFDGGIG
    N315            KFDKKGYEVNKKIKFDRFKFYNSKAHPDLTVKVREKDNIVKGIILVRDEKIHTNFDGGIG
    NCTC8325        KFDKKGYEVNKKIKFDRFKFYNSKAHPDLTVKVREKDNIVKGIILVRDEKIHTNFDGGIG
    Newman          KFDKKGYEVNKKIKFDRFKFYNSKAHPDLTVKVREKDNIVKGIILVRDEKIHTNFDGGIG
    USA300_FPR3757  KFDKKGYEVNKKIKFDRFKFYNSKAHPDLTVKVREKDNIVKGIILVRDEKIHTNFDGGIG
                    ************************************************************

    COL             SPINNAIENLGFGYKRTKVGNDFSSVKYIDRDNHLKLNLLYQDLEIKRIEFFSK
    N315            SPINNAIENLGFGYKRTKVGNDFSSVKYIDRDNHLKLNLLYQDLEIKRIEFFSK
    NCTC8325        SPINNAIENLGFGYKRTKVGNDFSSVKYIDRDNHLKLNLLYQDLEIKRIEFFSK
    Newman          SPINNAIENLGFGYKRTKVGNDFSSVKYIDRDNHLKLNLLYQDLEIKRIEFFSK
    USA300_FPR3757  SPINNAIENLGFGYKRTKVGNDFSSVKYIDRDNHLKLNLLYQDLEIKRIEFFSK
                    ******************************************************