From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004995000
  • symbol?:
  • description?: thioredoxin-like protein

      descriptions from strain specific annotations:

    • thioredoxin-like protein
    • Thioredoxin
  • strand?: +
  • coordinates?: 5177534..5178127
  • synteny block?: BlockID0038760
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1887
    08BA02176:
    C248_2016
    11819-97:
    MS7_1964
    71193:
    ST398NM01_2050
    ECT-R 2:
    ECTR2_1801
    ED133:
    SAOV_2031
    ED98:
    SAAV_1996
    HO 5096 0412:
    SAEMRSA15_18450
    JH1:
    SaurJH1_2019
    JH9:
    SaurJH9_1986
    JKD6008:
    SAA6008_01967
    JKD6159:
    SAA6159_01860
    LGA251:
    SARLGA251_18130
    M013:
    M013TW_1966
    MRSA252:
    SAR2021
    MSHR1132:
    SAMSHR1132_17730
    MSSA476:
    SAS1853
    Mu3:
    SAHV_1914
    Mu50:
    SAV1929
    MW2:
    MW1870
    RF122:
    SAB1865
    ST398:
    SAPIG2050
    T0131:
    SAT0131_02059 (poxB)
    TCH60:
    HMPREF0772_11212
    TW20:
    SATW20_19230
    USA300_TCH1516:
    USA300HOU_1932
    VC40:
    SAVC_08905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNLETYFKNSQPLNEYIDGMKTNQDTVLSIYQSFELPEDDSRIKKIKEMNYSKVLVITE
    N315            MTNLETYFKNSQPLNEYIDGMKTNQDTVLSIYQSFELPEDDSRIKKIKEMNYSKVLVITE
    NCTC8325        MTNLETYFKNSQPLNEYIDGMKTNQDTVLSIYQSFELPEDDSRIKKIKEMNYSKVLVITE
    USA300_FPR3757  MTNLETYFKNSQPLNEYIDGMKTNQDTVLSIYQSFELPEDDSRIKKIKEMNYSKVLVITE
                    ************************************************************

    COL             DWCGDAMMNLPILKHISEALNLEVRVFHRDDDTKLIDQYLTNGKSRAIPIFVFLNDQFEQ
    N315            DWCGDAMMNLPILKHISEALNLEVRVFHRDDDTKLIDQYLTNGKSRAIPIFVFLNDQFEQ
    NCTC8325        DWCGDAMMNLPILKHISEALNLEVRVFHRDDDTKLIDQYLTNGKSRAIPIFVFLNDQFEQ
    USA300_FPR3757  DWCGDAMMNLPILKHISEALNLEVRVFHRDDDTKLIDQYLTNGKSRAIPIFVFLNDQFEQ
                    ************************************************************

    COL             ETVWGPRANEVQKFVTDVRADKLPSKDHPDYADLEKETHLVISNRYKTDASFWKAVYNSI
    N315            ETVWGPRANEVQKFVTDVRADKLPSKDHPDYADLEKETHLVISNRYKTDASFWKAVYNSI
    NCTC8325        ETVWGPRANEVQKFVTDVRADKLPSKDHPDYADLEKETHLVISNRYKTDASFWKAVYNSI
    USA300_FPR3757  ETVWGPRANEVQKFVTDVRADKLPSKDHPDYADLEKETHLVISNRYKTDASFWKAVYNSI
                    ************************************************************

    COL             LNKLENK
    N315            LNKLENK
    NCTC8325        LNKLENK
    USA300_FPR3757  LNKLENK
                    *******