From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005000000
  • symbol?: pmtR
  • description?: GntR family transcriptional regulator

      descriptions from strain specific annotations:

    • GntR family transcriptional regulator
    • regulatory protein GntR
    • Transcriptional regulator, GntR family
    • regulatory proteins, gntR family protein
    • bacterial regulatory s, gntR family protein
    • GntR family regulatory protein
  • strand?: -
  • coordinates?: 5181377..5181757
  • synteny block?: BlockID0038810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1892
    08BA02176:
    C248_2021
    11819-97:
    MS7_1969
    71193:
    ST398NM01_2055
    ECT-R 2:
    ECTR2_1806
    ED133:
    SAOV_2036
    ED98:
    SAAV_2001
    HO 5096 0412:
    SAEMRSA15_18500
    JH1:
    SaurJH1_2024
    JH9:
    SaurJH9_1991
    JKD6008:
    SAA6008_01962
    JKD6159:
    SAA6159_01865
    LGA251:
    SARLGA251_18180
    M013:
    M013TW_1971
    MRSA252:
    SAR2026
    MSHR1132:
    SAMSHR1132_17780
    MSSA476:
    SAS1858
    Mu3:
    SAHV_1919
    Mu50:
    SAV1934
    MW2:
    MW1875
    RF122:
    SAB1870c
    ST398:
    SAPIG2055
    T0131:
    SAT0131_02064
    TCH60:
    HMPREF0772_11207
    TW20:
    SATW20_19280
    USA300_TCH1516:
    USA300HOU_1937
    VC40:
    SAVC_08930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------------------MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEH
    N315            -------------------------MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEH
    NCTC8325        -------------------------MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEH
    Newman          MRHAYLQNCVYCVYCIYTEVDRGTLMKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEH
    USA300_FPR3757  -------------------------MKIILKNNSDFPIYEQIKQQVKQNILKGHVAPGEH
                                             ***********************************

    COL             LPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENL
    N315            LPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENL
    NCTC8325        LPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENL
    Newman          LPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENL
    USA300_FPR3757  LPSMRELAKDLQVSLITTKRAYEDLEKDGFVTTIRGKGTFVKEQDSSILKEKQFFTIENL
                    ************************************************************

    COL             VKELVNEAQAIEMSLEELQDILTFIYEEESS
    N315            VKELVNEAQAIEMSLEELQDILTFIYEEESS
    NCTC8325        VKELVNEAQAIEMSLEELQDILTFIYEEESS
    Newman          VKELVNEAQAIEMSLEELQDILTFIYEEESS
    USA300_FPR3757  VKELVNEAQAIEMSLEELQDILTFIYEEESS
                    *******************************