From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005017000
  • symbol?:
  • description?: Bacteriophage

      descriptions from strain specific annotations:

    • Bacteriophage
    • Phage protein
  • strand?: +
  • coordinates?: 5192280..5192540
  • synteny block?: BlockID0038980
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1900
    08BA02176:
    11819-97:
    MS7_1976
    71193:
    ST398NM01_2912
    ECT-R 2:
    ECTR2_1813
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18570
    JH1:
    SaurJH1_2033
    JH9:
    JKD6008:
    SAA6008_01956
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2034
    MSHR1132:
    MSSA476:
    SAS1865
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02075
    TCH60:
    HMPREF0772_11200
    TW20:
    SATW20_19350
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    NCTC8325        MCIVIYLIYSLIVYFICIINFFIMAAPFLMTNADYVWTPMTTVTLFILSLIIFLIFIKTK
    Newman          MCIVIYLIYSLIVYFICIINFFIMAAPFLMTNADYVWTPMTTVTLFILSLIIFLIFIKTK
                    ************************************************************

    NCTC8325        DVVHLTIFILNLLFSILYCLPILFYL
    Newman          DVVHLTIFILNLLFSILYCLPILFYL
                    **************************