From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005020000
  • symbol?: chp
  • description?: chemotaxis-inhibiting protein CHIPS

      descriptions from strain specific annotations:

    • chemotaxis-inhibiting protein CHIPS
    • chemotaxis inhibitory protein
    • Chemotaxis-inhibiting protein CHIPS, phage associated
    • chemotaxis inhibitory protein (CHIPS)
    • chemotaxis inhibitory protein CHIPS
  • strand?: +
  • coordinates?: 5194509..5194958
  • synteny block?: BlockID0039010
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1877 (chp)
    USA300_FPR3757:
    04-02981:
    SA2981_1902
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2913
    ECT-R 2:
    ECTR2_1815
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18590 (chp)
    JH1:
    SaurJH1_2035
    JH9:
    SaurJH9_2000
    JKD6008:
    JKD6159:
    SAA6159_01873 (chs)
    LGA251:
    M013:
    MRSA252:
    SAR2036 (chp)
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11197 (chp)
    TW20:
    USA300_TCH1516:
    USA300HOU_1947 (chp)
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKKMLEKEKAYKESFKNS
    NCTC8325        MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKKLLEKEKAYKESFKNS
    Newman          MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKKMLEKEKAYKESFKNS
    USA300_FPR3757  MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKKMLEKEKAYKESFKNS
                    *********************************************:**************

    N315            GLPTTLGKLDERLRNYLEKGTKNTAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGK
    NCTC8325        GLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGK
    Newman          GLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGK
    USA300_FPR3757  GLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGK
                    *****************:*****:************************************

    N315            MYKTYFFKKGESKSSYVINGPGKTNEYAY
    NCTC8325        MYKTYFFKKGESKSSYVINGPGKTNEYAY
    Newman          MYKTYFFKKGESKSSYVINGPGKTNEYAY
    USA300_FPR3757  MYKTYFFKKGESKSSYVINGPGKTNEYAY
                    *****************************