From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005023000
  • symbol?: sak
  • description?: staphylokinase precursor

      descriptions from strain specific annotations:

    • staphylokinase precursor
    • Staphylokinase
    • staphylokinase/Streptokinase family protein
  • strand?: -
  • coordinates?: 5196174..5198215
  • synteny block?: BlockID0039040
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1758 (sak)
    NCTC8325:
    Newman:
    NWMN_1880 (sak)
    USA300_FPR3757:
    04-02981:
    SA2981_1905 (sak)
    08BA02176:
    11819-97:
    MS7_1979 (sak)
    71193:
    ECT-R 2:
    ECTR2_1817
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18610 (sak)
    JH1:
    SaurJH1_2037
    JH9:
    SaurJH9_2002
    JKD6008:
    SAA6008_01953 (sak)
    JKD6159:
    SAA6159_01875 (sak)
    LGA251:
    M013:
    MRSA252:
    SAR2039 (sak)
    MSHR1132:
    SAMSHR1132_17870
    MSSA476:
    SAS1868
    Mu3:
    SAHV_1930 (sak)
    Mu50:
    SAV1944 (sak)
    MW2:
    MW1885 (sak)
    RF122:
    ST398:
    T0131:
    SAT0131_02078
    TCH60:
    HMPREF0772_11195 (sak)
    TW20:
    SATW20_19380 (sak)
    USA300_TCH1516:
    USA300HOU_1949 (sak)
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MLKRSLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVD
    NCTC8325        MLKRSLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVD
    Newman          MLKRGLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVD
    USA300_FPR3757  MLKRGLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVD
                    ****.*******************************************************

    N315            SKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYD
    NCTC8325        GKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYD
    Newman          GKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYD
    USA300_FPR3757  GKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYD
                    .***********************************************************

    N315            KNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
    NCTC8325        KNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVIIEKK
    Newman          KNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVIIEKK
    USA300_FPR3757  KNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVIIEKK
                    **************************************:****