From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005030000
  • symbol?:
  • description?: holin-like protein

      descriptions from strain specific annotations:

    • holin-like protein
    • Phage holin
    • holin, phage phi LC3 family
    • phage phi LC3 family holin
  • strand?: -
  • coordinates?: 5199173..5199427
  • synteny block?: BlockID0039110
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1907
    08BA02176:
    11819-97:
    MS7_1981
    71193:
    ECT-R 2:
    ECTR2_1819
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18630
    JH1:
    SaurJH1_2039
    JH9:
    SaurJH9_2004
    JKD6008:
    SAA6008_01951
    JKD6159:
    SAA6159_01877
    LGA251:
    M013:
    MRSA252:
    SAR2041
    MSHR1132:
    SAMSHR1132_17890
    MSSA476:
    SAS1870
    Mu3:
    SAHV_1932
    Mu50:
    SAV1946
    MW2:
    MW1887
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11193
    TW20:
    SATW20_19400
    USA300_TCH1516:
    USA300HOU_1952
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MINWKIRMKQKSFWVAILSAIFLFAQNIAKAIGYDIQVYTEQLTDGLNAILGFLVLTGVI
    NCTC8325        MINWKIRMKQKSFWVAILSAIFLFAQNIAKAIGYDIQVYTEQLTDGLNAILGFLVLTGVI
    Newman          MINWKIRMKQKSFWVAILSAIFLFAQNIAKAIGYDIQVYTEQLTDGLNAILGFLVLTGVI
    USA300_FPR3757  MINWKIRMKQKSFWVAILSAIFLFAQNIAKAIGYDIQVYTEQLTDGLNAILGFLVLTGVI
                    ************************************************************

    N315            QDPTTKGIGDSHQALEYEEPRRKY
    NCTC8325        QDPTTKGIGDSHQALEYEEPRRKY
    Newman          QDPTTKGIGDSHQALEYEEPRRKY
    USA300_FPR3757  QDPTTKGIGDSHQALEYEEPRRKY
                    ************************