Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005046000
  • symbol?:
  • description?: phi PVL orfs 18-19-like protein

      descriptions from strain specific annotations:

    • phi PVL orfs 18-19-like protein
    • phage protein
    • phage tail protein
    • Phi PVL hypothetical protein
    • phi77 protein
    • phage tail fiber protein
    • phi77 ORF004-like protein phage tail component
    • phage tail family protein
  • strand?: -
  • coordinates?: 5209420..5210739
  • synteny block?: BlockID0039240
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1915
    08BA02176:
    11819-97:
    MS7_1986
    71193:
    ST398NM01_2918
    ECT-R 2:
    ECTR2_1826
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18690
    JH1:
    SaurJH1_2045
    JH9:
    SaurJH9_2009
    JKD6008:
    SAA6008_02007
    JKD6159:
    SAA6159_01883
    LGA251:
    M013:
    MRSA252:
    SAR2049
    MSHR1132:
    SAMSHR1132_17940
    MSSA476:
    SAS1877
    Mu3:
    SAHV_1940
    Mu50:
    SAV1954
    MW2:
    MW1894
    RF122:
    ST398:
    T0131:
    SAT0131_02086
    TCH60:
    HMPREF0772_11187
    TW20:
    SATW20_19460
    USA300_TCH1516:
    USA300HOU_1958
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIDTIKVNNKTIPWLYVERGFEIPSFNYVLKTENVDGRSGSIYKGRRLESYSFDIPLVVR
    NCTC8325        MQDTIQIDNKTIGWLVVQRGFEIPSFNFVTEKENVKGRAGSIVKNRYLNDIEFDLPLIIR
    Newman          MIDTIKVNNKTIPWLYVERGFEIPSFNYVLKTENVDGRSGSIYKGRRLESYSFDIPLVVR
    USA300_FPR3757  MIDTIKVNNKTIPWLYVERGFEIPSFNYVLKTENVDGRSGSIYKGRRLESYSFDIPLVVR
                    * ***:::**** ** *:*********:* :.***.**:*** *.* *:. .**:**::*

    N315            NDYLSHNGIKTHDDVLNELVKFFNYEEQV--KLQFKSKDWYWNAYFEGPIKLHKEFAIPV
    NCTC8325        NEKLSPGGEKTHDDILEALVKFFNIKDLTPKKLKFKSQNWYWFAYFDGPLKLPKNPRGSV
    Newman          NDYLSHNGIKTHDDVLNELVKFFNYEEQV--KLQFKSKDWYWNAYFEGPIKLHKEFTIPV
    USA300_FPR3757  NDYLSHNGFKTHDDVLNELVKFFNYEEQV--KLQFKSKDWYWNAYFEGPIKLHKEFAIPV
                    *: ** .* *****:*: ****** :: .  **:***::*** ***:**:** *:   .*

    N315            KFTIKVVLTDPYKYSVTGNKNTAISDQVSVVNSGTADTPLIVEARAIKPSSYFMITKNDE
    NCTC8325        KFTIKVVLTDPYKYSVTGNKNTAISDQVSVVNSGTADTPLIVEARAIKPSSYFMITKNDE
    Newman          KFTIKVVLTDPYKYSVTGNKNTAISDQVSVVNSGTADTPLIVEARAIKSSSYFMITKNDE
    USA300_FPR3757  KFTIKVVLTDPYKYSVTGYKNTAISDQVSVVNSGTADTPLIVEARAIKPSSYFMITKNDE
                    ****************** *****************************.***********

    N315            DYFMVGDDEVTKEVKDYMPPVYHSEFRDFKGWTKMITEDIPSNDLGGKVGGDFVISNLGE
    NCTC8325        DYFMVGDDEVTKEVKDYMPPVYHSEFRDFKGWTKMITEDIPSNDLGGKVGGDFVISNLGE
    Newman          DYFMVGDDEVTKEVKDYMPPVYHSEFRDFKGWTKMITEDIPSNDLGGKVGGDFVISNLGE
    USA300_FPR3757  DYFMVGDDEVTKEVKDYMPPVYHSEFRDFKGWTKMITEDIPSNDLGGKVGGDFVISNLGE
                    ************************************************************

    N315            GYKATNFPDAKGWVGAGTKRGLPKAMTDFQITYKCIVEQKGKGAGRTAQHIYDSDGKLLA
    NCTC8325        GYKATNFPDAKGWVGAGTKRGLPKAMTDFQITYKCIVEQKGKGAGRTAQHIYDSDGKLLA
    Newman          GYKATNFPDAKGWVGAGTKRGLPKAMTDFQITYKCIVEQKGKGAGRTAQHIYDSDGKLLA
    USA300_FPR3757  GYKATNFSDAKGWVGAGTKRGLPKAMTDFQITYKCIVEQKGKGAGRTAQHIYDSDGKLLA
                    *******.****************************************************

    N315            SIGYENKYHDRKIGHIVVTLYNQKGDPKKIYDYQNKPIMYNLDRIVVYMRLRRVGNKFSI
    NCTC8325        SIGYENKYHDRKIGHIVVTLYNQKGDPKKIYDYQNKPIMYNLDRIVVYMRLRRVGNKFSI
    Newman          SIGYENKYHDRKIGHIVVTLYNQKGDPKKIYDYQNKPIMYNLDRIVVYMRLRRVGNKFSI
    USA300_FPR3757  SIGYENKYHDRKIGHIVVTLYNQKGDPKKIYDYQNKPIMYNLDRIVVYMRLRRVGNKFSI
                    ************************************************************

    N315            KTWKFDHIKDPDRRKPIDMDEKEWIDGGKFYQRPASIIAIYSAKYNGYKWMEMNGLGSFN
    NCTC8325        KTWKFDHIKDPDRRKPIDMDEKEWIDGGKFYQRPASIIAIYSAKYNGYKWMEMNGLGSFN
    Newman          KTWKFDHIKDPDRRKPIDMDEKEWIDGGKFYQRPASIIAIYSAKYNGYKWMEMNGLGSFN
    USA300_FPR3757  KTWKFDHIKDPDRRKPIDMDEKEWIDGGKFYQRPASIIAIYSAKYNGYKWMEMNGLGSFN
                    ************************************************************

    N315            TEILPKPKGARDVIIQKGDLVKIDMQAKSVVINEEPMLSEKSFGSNYFNVDSGYSELIIQ
    NCTC8325        TEILPKPKGARDVIIQKGDLVKIDMQAKSVVINEEPMLSEKSFGSNYFNVDSGYSELIIQ
    Newman          TEILPKPKGARDVIIQKGDLVKIDMQAKSVVINEEPMLSEKSFGSNYFNVDSGYSELIIQ
    USA300_FPR3757  TEILPKPKGARDVIIQKGDLVKIDMQAKSVVINEEPMLSEKSFGSNYFNVDSGYSELIIQ
                    ************************************************************

    N315            PENVFDTTVKWQDRYL
    NCTC8325        PENVFDTTVKWQDRYL
    Newman          PENVFDTTVKWQDRYL
    USA300_FPR3757  PENVFDTTVKWQDRYL
                    ****************