From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005052000
  • symbol?:
  • description?: phage protein
  • strand?: -
  • coordinates?: 5218493..5219882
  • synteny block?: BlockID0039290
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1917
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2921
    ECT-R 2:
    ECTR2_1829
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18720
    JH1:
    SaurJH1_2048
    JH9:
    SaurJH9_2012
    JKD6008:
    SAA6008_02011
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2052
    MSHR1132:
    SAMSHR1132_17970
    MSSA476:
    Mu3:
    SAHV_1942
    Mu50:
    SAV1956
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02090
    TCH60:
    HMPREF0772_11184
    TW20:
    SATW20_19490
    USA300_TCH1516:
    USA300HOU_1961
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MAKLKRNIIQLVEDPKANEIKLQTYLTPHFISFEIVYEAMDLIDDIEDENSTMKPREIAD
    Newman          MAKLKRNIIQLVEDPKANEIKLQTYLTPHFISFEIVYEAMDLIDDIEDENSTMKPREIAD
    USA300_FPR3757  MAKLKRNIIQLVEDPKANEIKLQTYLTPHFISFEIVYEAMDLIDDIEDENSTMKPREIAD
                    ************************************************************

    N315            RLMDMVVKIYDNQFTVKDLKERMHAPDGMNALREQVIFITQGQQTEETRNFIQNMK
    Newman          RLMDMVVKIYDNQFTVKDLKERMHAPDGMNALREQVIFITQGQQTEETRNFIQNMK
    USA300_FPR3757  RLMDMVVKIYDNQFAVKDLKERMHAPDGMNALREQVVFITQGQQTEETRNFIQNMK
                    **************:*********************:*******************