From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005110000
  • symbol?:
  • description?: phage protein
  • strand?: -
  • coordinates?: 5256746..5257066
  • synteny block?: BlockID0039650
  • occurrence?: in 53% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1952
    08BA02176:
    11819-97:
    MS7_2022
    71193:
    ST398NM01_2951
    ECT-R 2:
    ECTR2_1862
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19130
    JH1:
    SaurJH1_2084
    JH9:
    SaurJH9_2047
    JKD6008:
    SAA6008_02043
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2092
    MSHR1132:
    MSSA476:
    SAS1911
    Mu3:
    SAHV_1977
    Mu50:
    SAV1991
    MW2:
    MW1928
    RF122:
    ST398:
    T0131:
    SAT0131_02124
    TCH60:
    TW20:
    SATW20_19870
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MPHILNVTVPIPETHVLITKDEYEELIAYSLDPVWNMSDLKKKLKIASDETIKDRLLFHP
    NCTC8325        MPHILNVTVPIPETHVLITKDEYDELIGYSLDPVWNMSDLKKKLKIASDETIKDRLLFHP
                    ***********************:***.********************************

    N315            RLEKELRAQGIVHYPDENFNRWRFNARRMHKFVDEHFNEIYKGGHNK
    NCTC8325        RFEKELRAQGIVHYPDENFNRWRFNARKMNKFVDEHFNEIYK-ERIK
                    *:*************************:*:************  : *