From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005119000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • phage anti repressor
    • phage antirepressor protein
    • putative anti repressor
    • phage antirepressor family protein
    • phi77 ORF014-like protein, phage anti-repressor protein
    • bacteriophage antirepressor
  • strand?: -
  • coordinates?: 5260544..5262389
  • synteny block?: BlockID0039720
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1955
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2954
    ECT-R 2:
    ECTR2_1865
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19160
    JH1:
    SaurJH1_2087
    JH9:
    SaurJH9_2050
    JKD6008:
    SAA6008_02047
    JKD6159:
    SAA6159_01928
    LGA251:
    M013:
    MRSA252:
    SAR2096
    MSHR1132:
    MSSA476:
    SAS1914
    Mu3:
    SAHV_1980
    Mu50:
    SAV1994
    MW2:
    MW1932
    RF122:
    ST398:
    T0131:
    SAT0131_02128
    TCH60:
    TW20:
    SATW20_19910
    USA300_TCH1516:
    USA300HOU_2000
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MQALQTKSNIGEMFNIQEKENGEIAISGRELHQALEVKTPYKKWFERMSDYGFEENIDYI
    Newman          MQALQTKSNIGEMFNIQEKENGEIAISGRELHQALEVKTPYKKWFERMSDYGFEENIDYI
    USA300_FPR3757  MQALQTNSNIGEMFNIQEKENGEIAISGRELHQALEVKTAYKDWFPRMLKYGFEENTDYT
                    ******:********************************.**.** ** .****** ** 

    N315            VTDIFVHNPLGGRQNQTDHALTLDTAKEIAMIQRSEPGKRARQYFIQVEKAWNSPEMIMQ
    Newman          VTDIFVHNPLGGRQNQTDHALTLDTAKEIAMIQRSEPGKRARQYFIQVEKAWNSPEMIMQ
    USA300_FPR3757  AIAQKRATAQGNMTHYIDHALTLDTAKEIAMIQRSEPGKRARQYFIQVEKAWNSPEMIMQ
                    .      .. *.  :  *******************************************

    N315            RALKIANNTINQLETKIERDKPKIVFADAVATTKTSILVGELAKIIKQNGINIGQRRLFE
    Newman          RALKIANNTINQLETKIERDKPKIVFADAVATTKTSILVGELAKIIKQNGINIGQRRLFE
    USA300_FPR3757  RALKIANNTINQLETKIERDKPKIVFADAVATTKTSILVGELAKIIKQNGVNIGQRRLFE
                    **************************************************:*********

    N315            WLRQNGFLIKRKGVDYNMPTQYSMERELFEIKETSITHSDGHTSISKTPKVTGKGQQYFV
    Newman          WLRQNGFLIKRKGVDYNMPTQYSMERELFEIKETSITHSDGHTSISKTPKVTGKGQQYFV
    USA300_FPR3757  WLRQNGFLIKRKGVDYNMPTQYSMERELFEIKETSITHSDGHTSISKTPKVTGKGQQYFV
                    ************************************************************

    N315            NKFLGEKQTS
    Newman          NKFLGEKQTS
    USA300_FPR3757  NKFLGEKQTS
                    **********