From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005218000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • bacteriophage terminase small subunit
    • phage terminase family protein
    • putative terminase small subunit
  • strand?: -
  • coordinates?: 5379698..5380267
  • synteny block?: BlockID0040420
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19350
    JH1:
    JH9:
    JKD6008:
    SAA6008_02066
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1932
    Mu3:
    SAHV_1998
    Mu50:
    SAV2012
    MW2:
    MW1949
    RF122:
    SAB1894c
    ST398:
    T0131:
    SAT0131_02151
    TCH60:
    TW20:
    SATW20_20100
    USA300_TCH1516:
    USA300HOU_2021
    VC40:
    SAVC_09005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSELTAKQARFVNEYIRTLNVTQSAIKAGYNANSAHVTACRLLKKPHIKQYIQEQKDKII
    N315            MSELTAKQARFVNEYIRTLNVTQSAIKAGYSANSAHVTGCRLLKKPHIKQYIQEQKDKVI
    NCTC8325        MSELTAKQARFVNEYIRTLNVTQSAIKAGYNANSAHVTACRLLKKPHIKQYIQEQKDKII
    Newman          MSELTAKQARFVNEYIRTLNVTQSAIKAGYNANSAHVTACRLLKKPHIKQYIQEQKDKII
    USA300_FPR3757  MSELTAKQARFVNEYIRTLNVTQSAIKAGYNANSAHVTACRLLKKPHIKQYIQEQKDKII
                    ******************************.*******.*******************:*

    COL             DENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSGKVQLVYNEHVELIEVPIK
    N315            DENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSGKVQLVYNEHVELVEVPIK
    NCTC8325        DENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSGKVQLVYNEHVELIEVPIK
    Newman          DENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSGKVQLVYNEHVELIEVPIK
    USA300_FPR3757  DENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSGKVQLVYNEHVELIEVPIK
                    ******************************************************:*****

    COL             PSDRLKARDMLGKYHKLFTDKHDINGNVPIFINIGEWDGGDEGLDKAVKDVSNDNPNHTV
    N315            PSDRLKARDMLGKYHKLFTDKHDINGNVPIFINIGEWDGDDEDLDKTVQEVSNANPNHTV
    NCTC8325        PSDRLKARDMLGKYHKLFTDKHDINGNVPIFINIGEWDGGDEGLDKAVKDVSNDNPNHTV
    Newman          PSDRLKARDMLGKYHKLFTDKHDINGNVPIFINIGEWDGGDEGLDKAVKDVSNDNPNHTV
    USA300_FPR3757  PSDRLKARDMLGKYHKLFTDKHDINGNVPIFINIGEWDGGDEGLDKAVKDVSNDNPNHTV
                    ***************************************.**.***:*::*** ******

    COL             IVDDIPLEDYESIRFL
    N315            IVDDIPLED-------
    NCTC8325        IVDDIPLEDYESIRFL
    Newman          IVDDIPLEDYESIRFL
    USA300_FPR3757  IVDDIPLEDYESIRFL
                    *********