From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005241000
  • symbol?: groEL
  • description?: chaperonin GroEL

      descriptions from strain specific annotations:

    • chaperonin GroEL
    • chaperonin GroL
    • molecular chaperone GroEL
    • 60 kDa chaperonin
    • 60 kDa chaperonin GroEL
    • Heat shock protein 60 family chaperone GroEL
    • co-chaperonin GroEL
  • strand?: -
  • coordinates?: 5397381..5437151
  • synteny block?: BlockID0040500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2016 (groEL)
    N315:
    SA1836 (groEL)
    NCTC8325:
    SAOUHSC_02254 (groEL)
    Newman:
    NWMN_1937 (groEL)
    USA300_FPR3757:
    SAUSA300_1982 (groEL)
    04-02981:
    SA2981_1970 (groEL)
    08BA02176:
    C248_2032 (groEL)
    11819-97:
    MS7_2041 (groL)
    71193:
    ST398NM01_2066
    ECT-R 2:
    ECTR2_1880 (groL)
    ED133:
    SAOV_2066c (groEL)
    ED98:
    SAAV_2076 (groEL)
    HO 5096 0412:
    SAEMRSA15_19370 (groEL)
    JH1:
    SaurJH1_2103 (groEL)
    JH9:
    SaurJH9_2066 (groEL)
    JKD6008:
    SAA6008_02067 (groEL)
    JKD6159:
    SAA6159_01943 (groEL)
    LGA251:
    SARLGA251_18310 (groEL)
    M013:
    M013TW_1981
    MRSA252:
    SAR2116 (groEL)
    MSHR1132:
    SAMSHR1132_18510
    MSSA476:
    SAS1935 (groEL)
    Mu3:
    SAHV_2014 (groEL)
    Mu50:
    SAV2029 (groEL)
    MW2:
    MW1953 (groEL)
    RF122:
    SAB1913c (groEL)
    ST398:
    SAPIG2066 (groL)
    T0131:
    SAT0131_02175 (dltC)
    TCH60:
    HMPREF0772_11169 (groEL)
    TW20:
    SATW20_20120 (groEL)
    USA300_TCH1516:
    USA300HOU_2024 (groEL)
    VC40:
    SAVC_09025 (groEL)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
    N315            MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
    NCTC8325        MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
    Newman          MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
    USA300_FPR3757  MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
                    ************************************************************

    COL             LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
    N315            LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
    NCTC8325        LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
    Newman          LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
    USA300_FPR3757  LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
                    ************************************************************

    COL             KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
    N315            KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
    NCTC8325        KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
    Newman          KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
    USA300_FPR3757  KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
                    ************************************************************

    COL             LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
    N315            LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
    NCTC8325        LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
    Newman          LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
    USA300_FPR3757  LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
                    ************************************************************

    COL             SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
    N315            SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
    NCTC8325        SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
    Newman          SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
    USA300_FPR3757  SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
                    ************************************************************

    COL             DDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
    N315            DDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
    NCTC8325        DDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
    Newman          DDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
    USA300_FPR3757  DDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
                    ************************************************************

    COL             EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
    N315            EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
    NCTC8325        EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
    Newman          EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
    USA300_FPR3757  EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
                    ************************************************************

    COL             YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATN
    N315            YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATN
    NCTC8325        YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATN
    Newman          YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATN
    USA300_FPR3757  YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATN
                    ************************************************************

    COL             EWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
    N315            EWVNMLEAGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
    NCTC8325        EWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
    Newman          EWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
    USA300_FPR3757  EWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
                    ******* **************************************************