From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005271000
  • symbol?:
  • description?: carbon-nitrogen family hydrolase

      descriptions from strain specific annotations:

    • carbon-nitrogen family hydrolase
    • hydrolase in agr operon
    • hydrolase
    • Aliphatic amidase amiE
    • amidohydrolase
    • beta-ureidopropionase
    • carbon-nitrogen hydrolase family protein
    • hydrolase in agr operon (ORF 5)
    • nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
    • putative carbon-nitrogen hydrolase
  • strand?: +
  • coordinates?: 5441067..5441854
  • synteny block?: BlockID0040720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1975 (amiE)
    08BA02176:
    C248_2037
    11819-97:
    MS7_2046
    71193:
    ST398NM01_2071
    ECT-R 2:
    ECTR2_1885
    ED133:
    SAOV_2071
    ED98:
    SAAV_2081
    HO 5096 0412:
    SAEMRSA15_19420
    JH1:
    SaurJH1_2108
    JH9:
    SaurJH9_2071
    JKD6008:
    SAA6008_02072
    JKD6159:
    SAA6159_01948
    LGA251:
    SARLGA251_18360
    M013:
    M013TW_1986
    MRSA252:
    SAR2121
    MSHR1132:
    SAMSHR1132_18560
    MSSA476:
    SAS1940
    Mu3:
    SAHV_2019
    Mu50:
    SAV2034
    MW2:
    MW1958
    RF122:
    SAB1919
    ST398:
    SAPIG2071
    T0131:
    SAT0131_02181
    TCH60:
    HMPREF0772_11164
    TW20:
    SATW20_20170
    USA300_TCH1516:
    USA300HOU_2029
    VC40:
    SAVC_09050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVQIYQLPIVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNL
    N315            MKVQIYQLPIIFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNL
    NCTC8325        MKVQIYQLPIVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNL
    Newman          MKVQIYQLPIVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNL
    USA300_FPR3757  MKVQIYQLPIVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNL
                    **********:*************************************************

    COL             GQSFSFIKHLAEKYKVDIVAGSVSNIRNNQIFNTAFSVNKSGQLINEYDKVHLVPMLREH
    N315            GQSFSFIKHLAEKYKVDIVAGSVSNIRNYQIFNTAFSVNKSGQLINEYDKVHLVPMLREH
    NCTC8325        GQSFSFIKHLAEKYKVDIVAGSVSNIRNNQIFNTAFSVNKSGQLINEYDKVHLVPMLREH
    Newman          GQSFSFIKHLAEKYKVDIVAGSVSNIRNNQIFNTAFSVNKSGQLINEYDKVHLVPMLREH
    USA300_FPR3757  GQSFSFIKHLAEKYKVDIVAGSVSNIRNNQIFNTAFSVNKSGQLINEYDKVHLVPMLREH
                    **************************** *******************************

    COL             EFLTAGEYVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKIAFYVAQWPMSRLQHW
    N315            EFLTAGENVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKIAFYVAQWPMSRLQHW
    NCTC8325        EFLTAGEYVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKIAFYVAQWPMSRLQHW
    Newman          EFLTAGEYVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKIAFYVAQWPMSRLQHW
    USA300_FPR3757  EFLTAGEYVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKIAFYVAQWPMSRLQHW
                    ******* ****************************************************

    COL             HSLLKARAIENNMFVIGTNSTGFDGNTEYAGHSIVINPNGDLVGELNESADILTVDLNLN
    N315            HSLLKARAIENNMFVIGTNSTGFDGNTEYAGHSIVINPNGDLVGELNESADILTVDLNLN
    NCTC8325        HSLLKARAIENNMFVIGTNSTGFDGNTEYAGHSIVINPNGDLVGELNESADILTVDLNLN
    Newman          HSLLKARAIENNMFVIGTNSTGFDGNTEYAGHSIVINPNGDLVGELNESADILTVDLNLN
    USA300_FPR3757  HSLLKARAIENNMFVIGTNSTGFDGNTEYAGHSIVINPNGDLVGELNESADILTVDLNLN
                    ************************************************************

    COL             EVEQQRENIPVFKSIKLDLYK
    N315            EVEQQRENIPVFKSIKLDLYK
    NCTC8325        EVEQQRENIPVFKSIKLDLYK
    Newman          EVEQQRENIPVFKSIKLDLYK
    USA300_FPR3757  EVEQQRENIPVFKSIKLDLYK
                    *********************