From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005274000
  • symbol?: hld
  • description?: delta-hemolysin

      descriptions from strain specific annotations:

    • delta-hemolysin
    • delta-hemolysin precursor
    • RNAIII (delta-hemolysin)
    • delta lysin family protein
    • delta-hemolysin domain protein
    • Delta-lysin
    • pseudogene
  • strand?: -
  • coordinates?: 5442530..5442610
  • synteny block?: BlockID0040750
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2022 (hld)
    N315:
    SAS065 (hld)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1976 (hld)
    08BA02176:
    C248_2039 (hld)
    11819-97:
    MS7_2047 (hld)
    71193:
    ST398NM01_2072
    ECT-R 2:
    ECTR2_1886
    ED133:
    SAOV_2072c (hld)
    ED98:
    SAAV_2083
    HO 5096 0412:
    SAEMRSA15_19430 (hld)
    JH1:
    SaurJH1_2109
    JH9:
    SaurJH9_2072
    JKD6008:
    SAA6008_02073 (hld)
    JKD6159:
    SAA6159_02612 (hld)
    LGA251:
    SARLGA251_18370 (hld)
    M013:
    M013TW_1987
    MRSA252:
    SAR2122 (hld)
    MSHR1132:
    SAMSHR1132_18561
    MSSA476:
    SAS1940a
    Mu3:
    SAHV_2020 (hld)
    Mu50:
    SAV2035 (hld)
    MW2:
    MW1959 (hld)
    RF122:
    ST398:
    SAPIG2072
    T0131:
    SAT0131_02182
    TCH60:
    TW20:
    SATW20_20180 (hld)
    USA300_TCH1516:
    USA300HOU_2031 (hld)
    VC40:
    SAVC_09055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
    N315            MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
    NCTC8325        MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
    USA300_FPR3757  MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
                    ********************************************