From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005285000
  • symbol?: scrR
  • description?: sucrose operon repressor

      descriptions from strain specific annotations:

    • sucrose operon repressor
    • LacI family transcriptional regulator
    • bacterial regulatory s, lacI family protein
    • sucrose operon repressor (Scr operon regulatory protein)
    • Sucrose operon repressor ScrR, LacI family
  • strand?: -
  • coordinates?: 5450374..5451324
  • synteny block?: BlockID0040850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2030 (scrR)
    N315:
    SA1847 (scrR)
    NCTC8325:
    Newman:
    NWMN_1949 (scrR)
    USA300_FPR3757:
    04-02981:
    SA2981_1983 (scrR)
    08BA02176:
    C248_2046 (scrR)
    11819-97:
    MS7_2053
    71193:
    ST398NM01_2079
    ECT-R 2:
    ECTR2_1893
    ED133:
    SAOV_2079c
    ED98:
    SAAV_2090 (scrR)
    HO 5096 0412:
    SAEMRSA15_19500 (scrR)
    JH1:
    SaurJH1_2115
    JH9:
    SaurJH9_2079
    JKD6008:
    SAA6008_02080 (scrR)
    JKD6159:
    SAA6159_01955 (scrR)
    LGA251:
    SARLGA251_18440 (scrR)
    M013:
    M013TW_1994
    MRSA252:
    SAR2129 (scrR)
    MSHR1132:
    SAMSHR1132_18640
    MSSA476:
    SAS1947
    Mu3:
    SAHV_2027 (scrR)
    Mu50:
    SAV2042 (scrR)
    MW2:
    MW1966 (scrR)
    RF122:
    SAB1926c (scrR)
    ST398:
    SAPIG2079
    T0131:
    SAT0131_02192
    TCH60:
    HMPREF0772_11157 (scrR)
    TW20:
    SATW20_20250 (scrR)
    USA300_TCH1516:
    USA300HOU_2039 (scrR)
    VC40:
    SAVC_09090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNISDIAKLAGVSKSTVSRFLNNGSVSKKTSEKLTRIIAEHDYQPNQFAQSLRARQTHL
    N315            MKNISDIAKLAGVSKSTVSRFLNNGSVSKKTSEKLTRIIAEHDYQPNQFAQSLRARQTHL
    NCTC8325        MKNISDIAKLAGVSKSTVSRFLNNGSVSKKTSEKLTRIIAEHDYQPNQFAQSLRARQTHL
    Newman          MKNISDIAKLAGVSKSTVSRFLNNGSVSKKTSEKLTRIIAEHDYQPNQFAQSLRARQTHL
    USA300_FPR3757  MKNISDIAKLAGVSKSTVSRFLNNGSVSKKTSEKLTRIIAEHDYQPNQFAQSLRARQTHL
                    ************************************************************

    COL             IGAIIPRMNSYAVDETIKGLAKQCQKYESQLILNYTGLNIEAEIQALETLARSKVDGIVL
    N315            IGAIIPRMNSYAVDETIKGLAKQCQKYESQLILNYTGLNIEAEIQALETLARSKVDGIVL
    NCTC8325        IGAIIPRMNSYAVDETIKGLAKQCQKYESQLILNYTGLNIEAEIQALETLARSKVDGIVL
    Newman          IGAIIPRMNSYAVDETIKGLAKQCQKYESQLILNYTGLNIEAEIQALETLARSKVDGIVL
    USA300_FPR3757  IGAIIPRMNSYAVDETIKGLAKQCQKYESQLILNYTGLNIEAEIQALETLARSKVDGIVL
                    ************************************************************

    COL             MATDITERHIEVINKMNVPIVIVGQQHEQLHSIVHDDYKAGQIIGEWIGQQGYQQVEVFS
    N315            MATDITERHIEVINKMNVPIVIVGQQHEQLHSIVHDDYKAGQIIGEWIGQQGYQQVEVFS
    NCTC8325        MATDITERHIEVINKMNVPIVIVGQQHEQLHSIVHDDYKAGQIIGEWIGQQGYQQVEVFS
    Newman          MATDITERHIEVINKMNVPIVIVGQQHEQLHSIVHDDYKAGQIIGEWIGQQGYQQVEVFS
    USA300_FPR3757  MATDITERHIEVINKMNVPIVIVGQQHEQLHSIVHDDYKAGQIIGEWIGQQGYQQVEVFS
                    ************************************************************

    COL             VSEKDIAVGIHRKRGLLDQLAKYQIKPNIHETNFTYVEAQKDVANVLENVEQVDAVVGAT
    N315            VSEKDIAVGIHRKRGLLDQLAKYQIKPNIHETNFTYVEAQKDVANVLENVEQVDAVVGAT
    NCTC8325        VSEKDIAVGIHRKRGLLDQLAKYQIKPNIHETNFTYVEAQKDVANVLENVEQVDAVVGAT
    Newman          VSEKDIAVGIHRKRGLLDQLAKYQIKPNIHETNFTYVEAQKDVANVLENVEQVDAVVGAT
    USA300_FPR3757  VSEKDIAVGIHRKRGLLDQLAKYQIKPNIHETNFTYVEAQKDVANVLENVEQVDAVVGAT
                    ************************************************************

    COL             DTIALAAYKYYSDKKDVMKPHQIYGFGGDPMTQLVSPSIKTIHYNYFEAGQCAMEEIQQM
    N315            DTIALAAYKYYSDKNDVMKPHQIYGFGGDPMTQLVSPSIKTIHYNYFEAGQCAMEEIQQM
    NCTC8325        DTIALAAYKYYSDKKDVMKPHQIYGFGGDPMTQLVSPSIKTIHYNYFEAGQCAMEEIQQM
    Newman          DTIALAAYKYYSDKKDVMKPHQIYGFGGDPMTQLVSPSIKTIHYNYFEAGQCAMEEIQQM
    USA300_FPR3757  DTIALAAYKYYSDKKDVMKPHQIYGFGGDPMTQLVSPSIKTIHYNYFEAGQCAMEEIQQM
                    **************:*********************************************

    COL             LKKQDMPYSVTVDVNI
    N315            LKKQDMPYSVTVDVNI
    NCTC8325        LKKQDMPYSVTVDVNI
    Newman          LKKQDMPYSVTVDVNI
    USA300_FPR3757  LKKQDMPYSVTVDVNI
                    ****************