From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005290000
  • symbol?:
  • description?: putative transport system permease protein

      descriptions from strain specific annotations:

    • putative transport system permease protein
    • inner membrane protein YeeE
  • strand?: -
  • coordinates?: 5453276..5454270
  • synteny block?: BlockID0040900
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1986
    08BA02176:
    C248_2049
    11819-97:
    MS7_2056
    71193:
    ST398NM01_2083
    ECT-R 2:
    ECTR2_1896
    ED133:
    SAOV_2082c
    ED98:
    SAAV_2093
    HO 5096 0412:
    SAEMRSA15_19530
    JH1:
    SaurJH1_2119
    JH9:
    SaurJH9_2082
    JKD6008:
    SAA6008_02083
    JKD6159:
    SAA6159_01958
    LGA251:
    SARLGA251_18470
    M013:
    M013TW_1997
    MRSA252:
    SAR2132
    MSHR1132:
    SAMSHR1132_18670
    MSSA476:
    SAS1950
    Mu3:
    SAHV_2030
    Mu50:
    SAV2045
    MW2:
    MW1969
    RF122:
    SAB1929c
    ST398:
    SAPIG2083
    T0131:
    SAT0131_02195
    TCH60:
    HMPREF0772_11154
    TW20:
    USA300_TCH1516:
    USA300HOU_2042
    VC40:
    SAVC_09105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MWMIFSGLIVGGLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLIAITIQSIGLLILTA
    N315            MWMIFSGLIVGGLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLIAITIQSIGLLILTA
    NCTC8325        -------------------------------MYVQKNNKMFYALLIAITIQSIGLLILTA
    Newman          MWMIFSGLIVGGLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLIAITIQSIGLLILTA
    USA300_FPR3757  MWMIFSGLIVGGLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLIAITIQSIGLLILTA
                                                   *****************************

    COL             TDILQIPAHSFPILGTIIGSFIFGIGIVLAGGCATGTWYRAGEGLIGSWIALVLYAVTAA
    N315            TDILQIPAHSFPILGTIIGSFIFGIGIVLAGGCATGTWYRAGEGLIGSWIALVLYAVTAA
    NCTC8325        TDILQIPAHSFPILGTIIGSFIFGIGIVLAGGCATGTWYRAGEGLIGSWIALVLYAVTAA
    Newman          TDILQIPAHSFPILGTIIGSFIFGIGIVLAGGCATGTWYRAGEGLIGSWIALVLYAVTAA
    USA300_FPR3757  TDILQIPAHSFPILGTIIGSFIFGIGIVLAGGCATGTWYRAGEGLIGSWIALVLYAVTAA
                    ************************************************************

    COL             ITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILTIITIFLVVRTLNNKKVRVAV
    N315            ITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILTIITIFLVVRTLNNKKVRVAV
    NCTC8325        ITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILTIITIFLVVRTLNNKKVRVAV
    Newman          ITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILTIITIFLVVRTLNNKKVRVAV
    USA300_FPR3757  ITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILTIITIFLVVRTLNNKKVRVAV
                    ************************************************************

    COL             PKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
    N315            PKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
    NCTC8325        PKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
    Newman          PKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
    USA300_FPR3757  PKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
                    ************************************************************

    COL             LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVA
    N315            LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVA
    NCTC8325        LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVA
    Newman          LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVA
    USA300_FPR3757  LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVA
                    ************************************************************

    COL             GGCSIGNGLVETATMTWQGWIALASMIVGVWTMSHFIFVRPMKKVHQQSAKVKQQTQIV
    N315            GGCSIGNGLVETATMTWQGWIALASMIVGVWTMSHFIFVRPMKKVQQQSAKVKQQTQIV
    NCTC8325        GGCSIGNGLVETATMTWQGWIALASMIVGVWTMSHFIFVRPMKKVHQQSAKVKQQTQIV
    Newman          GGCSIGNGLVETATMTWQGWIALASMIVGVWTMSHFIFVRPMKKVHQQSAKVKQQTQIV
    USA300_FPR3757  GGCSIGNGLVETATMTWQGWIALASMIVGVWTMSHFIFVRPMKKVHQQSAKVKQQTQIV
                    *********************************************:*************