From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005291000
  • symbol?: rex
  • description?: redox-sensing transcriptional repressor Rex

      descriptions from strain specific annotations:

    • redox-sensing transcriptional repressor Rex
    • Redox-sensitive transcriptional regulator (AT-rich DNA-binding protein)
    • coA binding domain-containing protein
    • DNA-binding family protein
    • CoA-binding protein
    • Redox-sensitive transcriptional regulator Rex
  • strand?: -
  • coordinates?: 5454682..5455317
  • synteny block?: BlockID0040910
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1987
    08BA02176:
    C248_2050
    11819-97:
    MS7_2057
    71193:
    ST398NM01_2084
    ECT-R 2:
    ECTR2_1897
    ED133:
    SAOV_2083c
    ED98:
    SAAV_2094
    HO 5096 0412:
    SAEMRSA15_19540
    JH1:
    SaurJH1_2120
    JH9:
    SaurJH9_2083
    JKD6008:
    SAA6008_02084 (rex)
    JKD6159:
    SAA6159_01959 (rex)
    LGA251:
    SARLGA251_18480
    M013:
    M013TW_1998
    MRSA252:
    SAR2133
    MSHR1132:
    SAMSHR1132_18680
    MSSA476:
    SAS1951
    Mu3:
    SAHV_2031
    Mu50:
    SAV2046
    MW2:
    MW1970
    RF122:
    SAB1930c
    ST398:
    SAPIG2084
    T0131:
    SAT0131_02197 (ampA)
    TCH60:
    HMPREF0772_11153
    TW20:
    SATW20_21860
    USA300_TCH1516:
    VC40:
    SAVC_09110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDQVKIPRATLKRLPLYYRFVSSLKSKGIDRVNSKAISDALQIDSATIRRDFSYFGELG
    N315            MSDQVKIPRATLKRLPLYYRFVSSLKSKGIDRVNSKAISDALQIDSATIRRDFSYFGELG
    NCTC8325        MSDQVKIPRATLKRLPLYYRFVSSLKSKGIDRVNSKAISDALQIDSATIRRDFSYFGELG
    Newman          MSDQVKIPRATLKRLPLYYRFVSSLKSKGIDRVNSKAISDALQIDSATIRRDFSYFGELG
    USA300_FPR3757  MSDQVKIPRATLKRLPLYYRFVSSLKSKGIDRVNSKAISDALQIDSATIRRDFSYFGELG
                    ************************************************************

    COL             KKGYGYNIDSLLDFFKSELSESDMIKIAIVGVGNLGKALLTYNFSIHDDMTITEAFDVKE
    N315            KKGYGYNIDSLLDFFKSELSESDMIKIAIVGVGNLGKALLTYNFSIHDDMTITEAFDVKE
    NCTC8325        KKGYGYNIDSLLDFFKSELSESDMIKIAIVGVGNLGKALLTYNFSIHDDMTITEAFDVKE
    Newman          KKGYGYNIDSLLDFFKSELSESDMIKIAIVGVGNLGKALLTYNFSIHDDMTITEAFDVKE
    USA300_FPR3757  KKGYGYNIDSLLDFFKSELSESDMIKIAIVGVGNLGKALLTYNFSIHDDMTITEAFDVKE
                    ************************************************************

    COL             DVIGQKIGNVIVKDNDELITTLKKEEIDVVILTTPERVAQKVADELVQAGVKGILNFTPG
    N315            DVIGQKIGNVIVKDNDELITTLKKEEIDVVILTTPERVAQKVADELVQAGVKGILNFTPG
    NCTC8325        DVIGQKIGNVIVKDNDELITTLKKEEIDVVILTTPERVAQKVADELVQAGVKGILNFTPG
    Newman          DVIGQKIGNVIVKDNDELITTLKKEEIDVVILTTPERVAQKVADELVQAGVKGILNFTPG
    USA300_FPR3757  DVIGQKIGNVIVKDNDELITTLKKEEIDVVILTTPERVAQKVADELVQAGVKGILNFTPG
                    ************************************************************

    COL             RINTPSDVQVHQIDLGIELQSLLFFMKNYSE
    N315            RINTPSDVQVHQIDLGIELQSLLFFMKNYSE
    NCTC8325        RINTPSDVQVHQIDLGIELQSLLFFMKNYSE
    Newman          RINTPSDVQVHQIDLGIELQSLLFFMKNYSE
    USA300_FPR3757  RINTPSDVQVHQIDLGIELQSLLFFMKNYSE
                    *******************************