Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005296000
  • symbol?:
  • description?: DNA mismatch repair protein MutS

      descriptions from strain specific annotations:

    • DNA mismatch repair protein MutS
    • DNA mismatch repair protein MutS domain-containing protein
    • MutS-related protein, family 1
    • mutS domain V family protein
    • DNA mismatch repair protein-like protein
    • DNA mismatch repair ATPase
    • pseudogene
    • MutS family protein
    • membrane protein
  • strand?: +
  • coordinates?: 5458608..5460219
  • synteny block?: BlockID0040960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1989 (mutS)
    08BA02176:
    C248_2053
    11819-97:
    MS7_2060
    71193:
    ST398NM01_2087
    ECT-R 2:
    ECTR2_1899
    ED133:
    SAOV_2085
    ED98:
    SAAV_2096
    HO 5096 0412:
    SAEMRSA15_19560
    JH1:
    SaurJH1_2122
    JH9:
    SaurJH9_2085
    JKD6008:
    SAA6008_02086
    JKD6159:
    SAA6159_01961
    LGA251:
    SARLGA251_18510
    M013:
    M013TW_2001
    MRSA252:
    SAR2135
    MSHR1132:
    SAMSHR1132_18700
    MSSA476:
    SAS1953
    Mu3:
    SAHV_2033
    Mu50:
    SAV2048
    MW2:
    MW1972
    RF122:
    SAB1932
    ST398:
    SAPIG2087
    T0131:
    SAT0131_02199
    TCH60:
    HMPREF0772_11151 (mutS)
    TW20:
    SATW20_21880
    USA300_TCH1516:
    USA300HOU_2043 (mutS2)
    VC40:
    SAVC_09120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSTNQTFLIFVIAIILLTSVIGIVGRYMSRQRLLKSMETLWQTISPLEAFIRPNSHFDYE
    N315            MSTNQTFLIFVIAIILLTSVIGIVGRYMSRQRLLKSMETLWQTISPLEAFIRPNSHFDYE
    NCTC8325        MSTNQTFLIFVIAIILLTSVIGIVGRYMSRQRLLKSMETLWQTISPLEAFIRPNSHFDYE
    Newman          MSTNQTFLIFVIAIILLTSVIGIVGRYMSRQRLLKSMETLWQTISPLEAFIRPNSHFDYE
    USA300_FPR3757  MSTNQTFLIFVIAIILLTSVIGIVGRYMSRQRLLKSMETLWQTISPLEAFIRPNSHFDYE
                    ************************************************************

    COL             YKLYKEKFESHSLVDDKTWSDLNMNAIFHKMNYNLTAIGEMKLYACLRGMLSITNKSLLS
    N315            YKLYKEKFESHSLVDDKTWSDLNMNAIFHKMNYNLTAIGEMKLYACLRGMLSITNKSLLS
    NCTC8325        YKLYKEKFESHSLVDDKTWSDLNMNAIFHKMNYNLTAIGEMKLYACLRGMLSITNKSLLS
    Newman          YKLYKEKFESHSLVDDKTWSDLNMNAIFHKMNYNLTAIGEMKLYACLRGMLSITNKSLLS
    USA300_FPR3757  YKLYKEKFESHSLVDDKTWSDLNMNAIFHKMNYNLTAIGEMKLYACLRGMLSITNKSLLS
                    ************************************************************

    COL             LFNDNAEFRKNVTYHLALIGKTVYPTFPDQITPVKRQNILFLCPFLPVISFAVIFINSQV
    N315            LFNDNAEFRKNVTYHLALIGKTVYPTFPDQITPVKRQNILFLCPFLPVISFAVIFINSQV
    NCTC8325        LFNDNAEFRKNVTYHLALIGKTVYPTFPDQITPVKRQNILFLCPFLPVISFAVIFINSQV
    Newman          LFNDNAEFRKNVTYHLALIGKTVYPTFPDQITPVKRQNILFLCPFLPVISFAVIFINSQV
    USA300_FPR3757  LFNDNAEFRKNVTYHLALIGKTVYPTFPDQITPVKRQNILFLCPFLPVISFAVIFINSQV
                    ************************************************************

    COL             GILLFLMSCLFNIILSATLKRTYEDDLKSIFYASNVLKQGYTISKIKHAPQPEVNFKQFR
    N315            GILLFLMSCLFNIILSATLKRTYEDDLKSIFYASNVLKQGYTISKIKHAPQPEVNFKQFR
    NCTC8325        GILLFLMSCLFNIILSATLKRTYEDDLKSIFYASNVLKQGYTISKIKHAPQPEVNFKQFR
    Newman          GILLFLMSCLFNIILSATLKRTYEDDLKSIFYASNVLKQGYTISKIKHAPQPEVNFKQFR
    USA300_FPR3757  GILLFLMSCLFNIILSATLKRTYEDDLKSIFYASNVLKQGYTISKIKHAPQPEVNFKQFR
                    ************************************************************

    COL             TARHLTSVLAEVNDEDIGAMVIKLVKLIFMLDYVLFHSIQKSYTTHMNELKNCFDYIAEL
    N315            TARHLTSVLAEVNDEDIGAMVIKLVKLIFMLDYVLFHSIQKSYTTHMNELKNCFDYIAEL
    NCTC8325        TARHLTSVLAEVNDEDIGAMVIKLVKLIFMLDYVLFHSIQKSYTTHMNELKNCFDYIAEL
    Newman          TARHLTSVLAEVNDEDIGAMVIKLVKLIFMLDYVLFHSIQKSYTTHMNELKNCFDYIAEL
    USA300_FPR3757  TARHLTSVLAEVNDEDIGAMVIKLVKLIFMLDYVLFHSIQKSYTTHMNELKNCFDYIAEL
                    ************************************************************

    COL             DNHYALAMYRRTLECYTEPQIDDSNDGIVFSELTHPLIADAVANDFSLSQNILLTGSNAS
    N315            DNHYALAMYRRTLECYTEPQIDDTNDGIVFSELTHPLIADAVANDFSLSQNILLTGSNAS
    NCTC8325        DNHYALAMYRRTLECYTEPQIDDSNDGIVFSELTHPLIADAVANDFSLSQNILLTGSNAS
    Newman          DNHYALAMYRRTLECYTEPQIDDSNDGIVFSELTHPLIADAVANDFSLSQNILLTGSNAS
    USA300_FPR3757  DNHYALAMYRRTLECYTEPQIDDSNDGIVFSELTHPLIADAVANDFSLSQNILLTGSNAS
                    ***********************:************************************

    COL             GKSTFMKSIAINIILASAIQTVTASKFVYQPGIVFTSMANADDVLSGDSYFMAELKSIKR
    N315            GKSTFMKSIAINIILASAIQTVTASKFVYQPGIVFTSMANADDVLSGDSYFMAELKSIKR
    NCTC8325        GKSTFMKSIAINIILASAIQTVTASKFVYQPGIVFTSMANADDVLSGDSYFMAELKSIKR
    Newman          GKSTFMKSIAINIILASAIQTVTASKFVYQPGIVFTSMANADDVLSGDSYFMAELKSIKR
    USA300_FPR3757  GKSTFMKSIAINIILASAIQTVTASKFVYQPGIVFTSMANADDVLSGDSYFMAELKSIKR
                    ************************************************************

    COL             IVEIPDNQKIYCFIDEIFKGTNTTERIAASESVLSFLHEKSNFRVIAATHDIELAELLKQ
    N315            IVEIPDNQKIYCFIDEIFKGTNTTERIAASESVLSFLHEKSNFRVIAATHDIELAELLKQ
    NCTC8325        IVEIPDNQKIYCFIDEIFKGTNTTERIAASESVLSFLHEKSNFRVIAATHDIELAELLKQ
    Newman          IVEIPDNQKIYCFIDEIFKGTNTTERIAASESVLSFLHEKSNFRVIAATHDIELAELLKQ
    USA300_FPR3757  IVEIPDNQKIYCFIDEIFKGTNTTERIAASESVLSFLHEKSNFRVIAATHDIELAELLKQ
                    ************************************************************

    COL             RYENYHFNEVIENNNIHFDYKIKPGKANTRNAIELLKITSFPAKIYERAKDNVPKI
    N315            RYENYHFNEVIENNNIHFDYKIKPGKANTRNAIELLKITSFPAKIYERAKDNVSNG
    NCTC8325        RYENYHFNEVIENNNIHFDYKIKPGKANTRNAIELLKITSFPAKIYERAKDNVPKI
    Newman          RYENYHFNEVIENNNIHFDYKIKPGKANTRNAIELLKITSFPAKIYERAKDNVPKI
    USA300_FPR3757  RYENYHFNEVIENNNIHFDYKIKPGKANTRNAIELLKITSFPAKIYERAKDNVPKI
                    *****************************************************.: