From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005299000
  • symbol?: rimI
  • description?: ribosomal-protein-alanine N-acetyltransfer

      descriptions from strain specific annotations:

    • ribosomal-protein-alanine N-acetyltransfer
    • ribosomal-protein-alanine acetyltransferase
    • ribosomal-protein-alanine N-acetyltransferase
    • ribosomal-protein-alanine acetyltransferase, putative
    • putative acetyltransferase
    • Ribosomal-protein-S18p-alanine acetyltransferase
    • ribosomal-protein-S18-alanine acetyltransferase
    • Acetyltransferase
  • strand?: -
  • coordinates?: 5461746..5462156
  • synteny block?: BlockID0040990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1957 (rimJ)
    USA300_FPR3757:
    04-02981:
    SA2981_1991
    08BA02176:
    C248_2055
    11819-97:
    MS7_2062 (rimI)
    71193:
    ST398NM01_2089
    ECT-R 2:
    ECTR2_1901 (rimI)
    ED133:
    SAOV_2087c
    ED98:
    SAAV_2098
    HO 5096 0412:
    SAEMRSA15_19580
    JH1:
    SaurJH1_2124
    JH9:
    SaurJH9_2087
    JKD6008:
    SAA6008_02088 (rimI)
    JKD6159:
    SAA6159_01963 (rimI)
    LGA251:
    SARLGA251_18530
    M013:
    M013TW_2003
    MRSA252:
    SAR2137
    MSHR1132:
    SAMSHR1132_18720
    MSSA476:
    SAS1955
    Mu3:
    SAHV_2035
    Mu50:
    SAV2050
    MW2:
    MW1974
    RF122:
    SAB1935c
    ST398:
    SAPIG2089 (rimI)
    T0131:
    SAT0131_02203
    TCH60:
    HMPREF0772_11149 (rimI)
    TW20:
    SATW20_21900
    USA300_TCH1516:
    USA300HOU_2045
    VC40:
    SAVC_09130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDQQSKEQLNIREMTKEDVPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQ
    N315            MDQQSKEQLNIREMTKEDVPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQ
    NCTC8325        ------------------MPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQ
    Newman          MDQQSKEQLNIREMTKEDVPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQ
    USA300_FPR3757  MDQQSKEQLNIREMTKEDVPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQ
                                      :*****************************************

    COL             IIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKYGINYASHTCDVMSLEVRVNNKVA
    N315            IIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKYGINYASHTCDVMSLEVRVNNKVA
    NCTC8325        IIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKYGINYASHTCDVMSLEVRVNNKVA
    Newman          IIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKYGINYASHTCDVMSLEVRVNNKVA
    USA300_FPR3757  IIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKYGINYASHTCDVMSLEVRVNNKVA
                    ************************************************************

    COL             QHVYENLGFQYGGKRKNYYGEGEDAMVMWVNLND
    N315            QHVYENLGFQYGGKRKNYYGEGEDAMVMWVNLND
    NCTC8325        QHVYENLGFQYGGKRKNYYGEGEDAMVMWVNLND
    Newman          QHVYENLGFQYGGKRKNYYGEGEDAMVMWVNLND
    USA300_FPR3757  QHVYENLGFQYGGKRKNYYGEGEDAMVMWVNLND
                    **********************************