From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005304000
  • symbol?: ilvB
  • description?: acetolactate synthase large subunit

      descriptions from strain specific annotations:

    • acetolactate synthase large subunit
    • acetolactate synthase, large subunit, biosynthetic type
  • strand?: +
  • coordinates?: 5465508..5467292
  • synteny block?: BlockID0041040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2043 (ilvB)
    N315:
    SA1859 (ilvB)
    NCTC8325:
    Newman:
    NWMN_1961 (ilvB)
    USA300_FPR3757:
    04-02981:
    SA2981_1995 (ilvB)
    08BA02176:
    C248_2060 (ilvB)
    11819-97:
    MS7_2066 (ilvB)
    71193:
    ST398NM01_2093
    ECT-R 2:
    ECTR2_1905 (ilvB)
    ED133:
    SAOV_2091 (ilvB)
    ED98:
    SAAV_2102 (ilvB)
    HO 5096 0412:
    SAEMRSA15_19620 (ilvB)
    JH1:
    SaurJH1_2128
    JH9:
    SaurJH9_2091
    JKD6008:
    SAA6008_02092 (ilvB)
    JKD6159:
    SAA6159_01967 (ilvB)
    LGA251:
    SARLGA251_18570 (ilvB)
    M013:
    M013TW_2007
    MRSA252:
    SAR2141 (ilvB)
    MSHR1132:
    SAMSHR1132_18760
    MSSA476:
    SAS1959
    Mu3:
    SAHV_2039 (ilvB)
    Mu50:
    SAV2054 (ilvB)
    MW2:
    MW1978 (ilvB)
    RF122:
    SAB1939 (ilvB)
    ST398:
    SAPIG2093 (ilvB)
    T0131:
    SAT0131_02207
    TCH60:
    HMPREF0772_11144 (ilvB)
    TW20:
    SATW20_21940 (ilvB)
    USA300_TCH1516:
    USA300HOU_2049 (ilvB1)
    VC40:
    SAVC_09150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKTQHEVNQNIDPLKMAESLEPEQLNEKTLNDMRSGSEVLVEALLKENVDYLFGYPGGA
    N315            MSKTQHEVNQNIDPLKMAESLELEQLNEKTLNDMRSGSEVLVEALLKENVDYLFGYPGGA
    NCTC8325        MSKTQHEVNQNIDPLKMAESLEPEQLNEKTLNDMRSGSEVLVEALLKENVDYLFGYPGGA
    Newman          MSKTQHEVNQNIDPLKMAESLEPEQLNEKTLNDMRSGSEVLVEALLKENVDYLFGYPGGA
    USA300_FPR3757  MSKTQHEVNQNIDPLKMAESLEPEQLNEKTLNDMRSGSEVLVEALLKENVDYLFGYPGGA
                    ********************** *************************************

    COL             VLPLYDTFYDGKIKHILARHEQGAVHAAEGYARVSGKTGVVVVTSGPGATNVMTGITDAH
    N315            VLPLYDTFYDGKIKHILARHEQGAVHAAEGYARVSGKTGVVVVTSGPGATNVMTGITDAH
    NCTC8325        VLPLYDTFYDGKIKHILARHEQGAVHAAEGYARVSGKTGVVVVTSGPGATNVMTGITDAH
    Newman          VLPLYDTFYDGKIKHILARHEQGAVHAAEGYARVSGKTGVVVVTSGPGATNVMTGITDAH
    USA300_FPR3757  VLPLYDTFYDGKIKHILARHEQGAVHAAEGYARVSGKTGVVVVTSGPGATNVMTGITDAH
                    ************************************************************

    COL             CDSLPLVVFTGQVATPGIGKDAFQEADILSMTSPITKQNYQVKRVEDIPKIVHEAFHVAN
    N315            CDSLPLVVFTGQVATPGIGKDAFQEADILSMTSPITKQNYQVKRVEDIPKIVHEAFHVAN
    NCTC8325        CDSLPLVVFTGQVATPGIGKDAFQEADILSMTSPITKQNYQVKRVEDIPKIVHEAFHVAN
    Newman          CDSLPLVVFTGQVATPGIGKDAFQEADILSMTSPITKQNYQVKRVEDIPKIVHEAFHVAN
    USA300_FPR3757  CDSLPLVVFTGQVATPGIGKDAFQEADILSMTSPITKQNYQVKRVEDIPKIVHEAFHVAN
                    ************************************************************

    COL             SGRKGPVVIDFPKDMGVLATNVDLCDEINIPGYEVVTEPENKDIDTFISLLKEAKKPVVL
    N315            SGRKGPVVIDFPKDMGVLATNVDLCDEINIPGYEVVTEPENKDIDTFISLLKEAKKPVVL
    NCTC8325        SGRKGPVVIDFPKDMGVLATNVDLCDEINIPGYEVVTEPENKDIDTFISLLKEAKKPVVL
    Newman          SGRKGPVVIDFPKDMGVLATNVDLCDEINIPGYEVVTEPENKDIDTFISLLKEAKKPVVL
    USA300_FPR3757  SGRKGPVVIDFPKDMGVLATNVDLCDEINIPGYEVVTEPENKDIDTFISLLKEAKKPVVL
                    ************************************************************

    COL             AGAGINQSKSNQLLTQFVNKHQIPTVTTLLGLGAVPYEDTLFLGMGGMHGSYASNMALTE
    N315            AGAGINQSKSNQLLTQFVNKHQIPTVTTLLGLGAVPYEDTLFLGMGGMHGSYASNMALTE
    NCTC8325        AGAGINQSKSNQLLTQFVNKHQIPTVTTLLGLGAVPYEDTLFLGMGGMHGSYASNMALTE
    Newman          AGAGINQSKSNQLLTQFVNKHQIPTVTTLLGLGAVPYEDTLFLGMGGMHGSYASNMALTE
    USA300_FPR3757  AGAGINQSKSNQLLTQFVNKHQIPTVTTLLGLGAVPYEDTLFLGMGGMHGSYASNMALTE
                    ************************************************************

    COL             CDLLINLGSRFDDRLASKPDAFAPNAKIVHVDIDPSEINKVIHVDLGIIADCKRFLECLN
    N315            CDLLINLGSRFDDRLASKPDAFAPNAKIVHVDIDPSEINKVIHVDLGIIADCKRFLECLN
    NCTC8325        CDLLINLGSRFDDRLASKPDAFAPNAKIVHVDIDPSEINKVIHVDLGIIADCKRFLECLN
    Newman          CDLLINLGSRFDDRLASKPDAFAPNAKIVHVDIDPSEINKVIHVDLGIIADCKRFLECLN
    USA300_FPR3757  CDLLINLGSRFDDRLASKPDAFAPNAKIVHVDIDPSEINKVIHVDLGIIADCKRFLECLN
                    ************************************************************

    COL             DKNVETIEHSDWVKHCQNNKQKHPFKLGEEDQVFCKPQQTIEYIGKITNGEAIVTTDVGQ
    N315            DKNVETIEHSDWVKHCQNNKQKHPFKLGEEDQVFCKPQQTIEYIGKITNGEAIVTTDVGQ
    NCTC8325        DKNVETIEHSDWVKHCQNNKQKHPFKLGEEDQVFCKPQQTIEYIGKITNGEAIVTTDVGQ
    Newman          DKNVETIEHSDWVKHCQNNKQKHPFKLGEEDQVFCKPQQTIEYIGKITNGEAIVTTDVGQ
    USA300_FPR3757  DKNVETIEHSDWVKHCQNNKQKHPFKLGEEDQVFCKPQQTIEYIGKITNGEAIVTTDVGQ
                    ************************************************************

    COL             HQMWAAQFYPFKNHGQWVTSGGLGTMGFGIPSSIGAKLANPDKTVVCFVGDGGFQMTNQE
    N315            HQMWAAQFYPFKNHGQWVTSGGLGTMGFGIPSSIGAKLANPDKTVVCFVGDGGFQMTNQE
    NCTC8325        HQMWAAQFYPFKNHGQWVTSGGLGTMGFGIPSSIGAKLANPDKTVVCFVGDGGFQMTNQE
    Newman          HQMWAAQFYPFKNHGQWVTSGGLGTMGFGIPSSIGAKLANPDKTVVCFVGDGGFQMTNQE
    USA300_FPR3757  HQMWAAQFYPFKNHGQWVTSGGLGTMGFGIPSSIGAKLANPDKTVVCFVGDGGFQMTNQE
                    ************************************************************

    COL             MALLPEYGLDVKIVLINNGTLGMVKQWQDKFFNQRFSHSVFNGQPDFMKMAEAYGVKGFL
    N315            MALLPEYGLDVKIVLINNGTLGMVKQWQDKFFNQRFSHSVFNGQPDFMKMAEAYGVKGFL
    NCTC8325        MALLPEYGLDVKIVLINNGTLGMVKQWQDKFFNQRFSHSVFNGQPDFMKMAEAYGVKGFL
    Newman          MALLPEYGLDVKIVLINNGTLGMVKQWQDKFFNQRFSHSVFNGQPDFMKMAEAYGVKGFL
    USA300_FPR3757  MALLPEYGLDVKIVLINNGTLGMVKQWQDKFFNQRFSHSVFNGQPDFMKMAEAYGVKGFL
                    ************************************************************

    COL             IDKPEQLEEQLDAAFAYQGPALIEVRISPTEAVTPMVPSGKSNHEMEGL
    N315            IDKPEQLEEQLDAAFAYQGPVLIEVRISPTEAVTPMVPSGKSNHEMEGL
    NCTC8325        IDKPEQLEEQLDAAFAYQGPALIEVRISPTEAVTPMVPSGKSNHEMEGL
    Newman          IDKPEQLEEQLDAAFAYQGPALIEVRISPTEAVTPMVPSGKSNHEMEGL
    USA300_FPR3757  IDKPEQLEEQLDAAFAYQGPALIEVRISPTEAVTPMVPSGKSNHEMEGL
                    ********************.****************************