From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005309000
  • symbol?: leuC
  • description?: isopropylmalate isomerase large subunit

      descriptions from strain specific annotations:

    • isopropylmalate isomerase large subunit
    • 3-isopropylmalate dehydratase large subunit
    • 3-isopropylmalate dehydratase, large subunit
    • 3-isopropylmalate dehydratase large subunit (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI)
  • strand?: +
  • coordinates?: 5471312..5472683
  • synteny block?: BlockID0041090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2048 (leuC)
    N315:
    SA1864 (leuC)
    NCTC8325:
    Newman:
    NWMN_1965 (leuC)
    USA300_FPR3757:
    04-02981:
    SA2981_2000 (leuC)
    08BA02176:
    C248_2065 (leuC)
    11819-97:
    MS7_2071 (leuC)
    71193:
    ST398NM01_2098
    ECT-R 2:
    ECTR2_1910 (leuC)
    ED133:
    SAOV_2096 (leuC)
    ED98:
    SAAV_2107 (leuC)
    HO 5096 0412:
    SAEMRSA15_19670 (leuC)
    JH1:
    SaurJH1_2133
    JH9:
    SaurJH9_2096
    JKD6008:
    SAA6008_02097 (leuC)
    JKD6159:
    SAA6159_01972 (leuC)
    LGA251:
    SARLGA251_18620 (leuC)
    M013:
    M013TW_2012
    MRSA252:
    SAR2146 (leuC)
    MSHR1132:
    SAMSHR1132_18810 (leuC)
    MSSA476:
    SAS1964
    Mu3:
    SAHV_2044 (leuC)
    Mu50:
    SAV2059 (leuC)
    MW2:
    MW1983 (leuC)
    RF122:
    SAB1944 (leuC)
    ST398:
    SAPIG2098 (leuC)
    T0131:
    SAT0131_02212
    TCH60:
    HMPREF0772_11139 (leuC)
    TW20:
    SATW20_21990 (leuC)
    USA300_TCH1516:
    USA300HOU_2054 (leuC)
    VC40:
    SAVC_09175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGQTLFDKVWNRHVLYGKLGEPQLLYIDLHLIHEVTSPQAFEGLRLQNRKLRRPDLTFAT
    N315            MGQTLFDKVWNRHVLYGKLGEPQLLYIDLHLIHEVTSPQAFEGLRLQNRKLRRPDLTFAT
    NCTC8325        MGQTLFDKVWNRHVLYGKLGEPQLLYIDLHLIHEVTSPQAFEGLRLQNRKLRRPDLTFAT
    Newman          MGQTLFDKVWNRHVLYGKLGEPQLLYIDLHLIHEVTSPQAFEGLRLQNRKLRRPDLTFAT
    USA300_FPR3757  MGQTLFDKVWNRHVLYGKLGEPQLLYIDLHLIHEVTSPQAFEGLRLQNRKLRRPDLTFAT
                    ************************************************************

    COL             LDHNVPTIDIFNIKDEIANKQITTLQKNAIDFGVHIFDMGSDEQGIVHMVGPETGLTQPG
    N315            LDHNVPTIDIFNIKDEIANKQITTLQKNAIDFGVHIFDMGSDEQGIVHMVGPETGLTQPG
    NCTC8325        LDHNVPTIDIFNIKDEIANKQITTLQKNAIDFGVHIFDMGSDEQGIVHMVGPETGLTQPG
    Newman          LDHNVPTIDIFNIKDEIANKQITTLQKNAIDFGVHIFDMGSDEQGIVHMVGPETGLTQPG
    USA300_FPR3757  LDHNVPTIDIFNIKDEIANKQITTLQKNAIDFGVHIFDMGSDEQGIVHMVGPETGLTQPG
                    ************************************************************

    COL             KTIVCGDSHTATHGAFGAIAFGIGTSEVEHVFATQTLWQTKPKNLKIDINGTLPTGVYAK
    N315            KTIVCGDSHTATHGAFGAIAFGIGTSEVEHVFATQTLWQTKPKNLKIDINGTLPTGVYAK
    NCTC8325        KTIVCGDSHTATHGAFGAIAFGIGTSEVEHVFATQTLWQTKPKNLKIDINGTLPTGVYAK
    Newman          KTIVCGDSHTATHGAFGAIAFGIGTSEVEHVFATQTLWQTKPKNLKIDINGTLPTGVYAK
    USA300_FPR3757  KTIVCGDSHTATHGAFGAIAFGIGTSEVEHVFATQTLWQTKPKNLKIDINGTLPTGVYAK
                    ************************************************************

    COL             DIILHLIKTYGVDFGTGYALEFTGETIKNLSMDGRMTICNMAIEGGAKYGIIQPDDITFE
    N315            DIILHLIKTYGVDFGTGYALEFTGETIKNLSMDGRMTICNMAIEGGAKYGIIQPDDITFE
    NCTC8325        DIILHLIKTYGVDFGTGYALEFTGETIKNLSMDGRMTICNMAIEGGAKYGIIQPDDITFE
    Newman          DIILHLIKTYGVDFGTGYALEFTGETIKNLSMDGRMTICNMAIEGGAKYGIIQPDDITFE
    USA300_FPR3757  DIILHLIKTYGVDFGTGYALEFTGETIKNLSMDGRMTICNMAIEGGAKYGIIQPDDITFE
                    ************************************************************

    COL             YVKGRPFADNFAKSVDKWRELYSDDDAIFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPF
    N315            YVKGRPFADNFAKSVDKWRELYSDDDAIFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPF
    NCTC8325        YVKGRPFADNFAKSVDKWRELYSDDDAIFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPF
    Newman          YVKGRPFADNFAKSVDKWRELYSDDDAIFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPF
    USA300_FPR3757  YVKGRPFADNFAKSVDKWRELYSDDDAIFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPF
                    ************************************************************

    COL             PEINDINDQRAYDYMGLEPGQKAEDIDLGYVFLGSCTNARLSDLIEASHIVKGNKVHPNI
    N315            PEINDINDQRAYDYMGLEPGQKAEDIDLGYVFLGSCTNARLSDLIEASHIVKGNKVHPNI
    NCTC8325        PEINDINDQRAYDYMGLEPGQKAEDIDLGYVFLGSCTNARLSDLIEASHIVKGNKVHPNI
    Newman          PEINDINDQRAYDYMGLEPGQKAEDIDLGYVFLGSCTNARLSDLIEASHIVKGNKVHPNI
    USA300_FPR3757  PEINDINDQRAYDYMGLEPGQKAEDIDLGYVFLGSCTNARLSDLIEASHIVKGNKVHPNI
                    ************************************************************

    COL             TAIVVPGSRTVKKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRN
    N315            TAIVVPGSRTVKKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRN
    NCTC8325        TAIVVPGSRTVKKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRN
    Newman          TAIVVPGSRTVKKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRN
    USA300_FPR3757  TAIVVPGSRTVKKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRN
                    ************************************************************

    COL             FEGRQGKGARTHLVSPAMAAAAAIHGKFVDVRKVVV
    N315            FEGRQGKGARTHLVSPAMAAAAAIHGKFVDVRKVVV
    NCTC8325        FEGRQGKGARTHLVSPAMAAAAAIHGKFVDVRKVVV
    Newman          FEGRQGKGARTHLVSPAMAAAAAIHGKFVDVRKVVV
    USA300_FPR3757  FEGRQGKGARTHLVSPAMAAAAAIHGKFVDVRKVVV
                    ************************************