From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005310000
  • symbol?: leuD
  • description?: 3-isopropylmalate dehydratase small subunit

      descriptions from strain specific annotations:

    • 3-isopropylmalate dehydratase small subunit
    • isopropylmalate isomerase small subunit
    • 3-isopropylmalate dehydratase, small subunit
    • 3-isopropylmalate dehydratase small subunit (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI)
  • strand?: +
  • coordinates?: 5472685..5473257
  • synteny block?: BlockID0041100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2049 (leuD)
    N315:
    SA1865 (leuD)
    NCTC8325:
    Newman:
    NWMN_1966 (leuD)
    USA300_FPR3757:
    04-02981:
    SA2981_2001 (leuD)
    08BA02176:
    C248_2066 (leuD)
    11819-97:
    MS7_2072 (leuD)
    71193:
    ST398NM01_2099
    ECT-R 2:
    ECTR2_1911 (leuD)
    ED133:
    SAOV_2097 (leuD)
    ED98:
    SAAV_2108 (leuD)
    HO 5096 0412:
    SAEMRSA15_19680 (leuD)
    JH1:
    SaurJH1_2134 (leuD)
    JH9:
    SaurJH9_2097 (leuD)
    JKD6008:
    SAA6008_02098 (leuD)
    JKD6159:
    SAA6159_01973 (leuD)
    LGA251:
    SARLGA251_18630 (leuD)
    M013:
    M013TW_2013
    MRSA252:
    SAR2147 (leuD)
    MSHR1132:
    SAMSHR1132_18830
    MSSA476:
    SAS1965 (leuD)
    Mu3:
    SAHV_2045 (leuD)
    Mu50:
    SAV2060 (leuD)
    MW2:
    MW1984 (leuD)
    RF122:
    SAB1945 (leuD)
    ST398:
    SAPIG2099 (leuD)
    T0131:
    SAT0131_02213
    TCH60:
    HMPREF0772_11138 (leuD)
    TW20:
    SATW20_22000 (leuD)
    USA300_TCH1516:
    USA300HOU_2055 (leuD)
    VC40:
    SAVC_09180 (leuD)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPD
    N315            MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPD
    NCTC8325        MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPD
    Newman          MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPD
    USA300_FPR3757  MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPD
                    ************************************************************

    COL             FNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAML
    N315            FNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAML
    NCTC8325        FNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAML
    Newman          FNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAML
    USA300_FPR3757  FNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAML
                    ************************************************************

    COL             PIVLEKSAREHLAQYVEIEVDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYE
    N315            PIVLEKSAREHLAQYEEIEIDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYE
    NCTC8325        PIVLEKSAREHLAQYVEIEVDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYE
    Newman          PIVLEKSAREHLAQYVEIEVDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYE
    USA300_FPR3757  PIVLEKSAREHLAQYVEIEVDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYE
                    *************** ***:****************************************

    COL             SLIEKYEKSL
    N315            SLIEKYEKSL
    NCTC8325        SLIEKYEKSL
    Newman          SLIEKYEKSL
    USA300_FPR3757  SLIEKYEKSL
                    **********