From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005347000
  • symbol?: kdpC
  • description?: potassium-transporting ATPase subunit C

      descriptions from strain specific annotations:

    • potassium-transporting ATPase subunit C
    • putative potassium-transporting ATPase C chain
    • Potassium-transporting ATPase C chain
    • P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit C
    • K+-transporting ATPase subunit C
    • Potassium-transporting ATPase C chain 1
    • K+-transporting ATPase, C subunit
  • strand?: -
  • coordinates?: 5520189..5520699
  • synteny block?: BlockID0041440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2066 (kdpC)
    N315:
    SA1879 (kdpC)
    NCTC8325:
    Newman:
    NWMN_1980 (kdpC)
    USA300_FPR3757:
    04-02981:
    SA2981_2016 (kdpC)
    08BA02176:
    C248_2087 (kdpC)
    11819-97:
    MS7_2092 (kdpC)
    71193:
    ST398NM01_2116
    ECT-R 2:
    ECTR2_1931 (kdpC)
    ED133:
    SAOV_2117c
    ED98:
    SAAV_2129 (kdpC)
    HO 5096 0412:
    SAEMRSA15_19850 (kdpC)
    JH1:
    SaurJH1_2150
    JH9:
    SaurJH9_2112
    JKD6008:
    SAA6008_02114 (kdpC)
    JKD6159:
    SAA6159_01990 (kdpC)
    LGA251:
    SARLGA251_18780 (kdpC)
    M013:
    M013TW_2034
    MRSA252:
    SAR2163 (kdpC)
    MSHR1132:
    SAMSHR1132_19000
    MSSA476:
    SAS1980
    Mu3:
    SAHV_2060 (kdpC)
    Mu50:
    SAV2075 (kdpC)
    MW2:
    MW1999 (kdpC)
    RF122:
    SAB1960c (kdpC)
    ST398:
    SAPIG2116 (kdpC)
    T0131:
    SAT0131_02232 (argG)
    TCH60:
    HMPREF0772_11120 (kdpC)
    TW20:
    SATW20_22150 (kdpC)
    USA300_TCH1516:
    USA300HOU_2070 (kdpC)
    VC40:
    SAVC_09260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT
    N315            MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT
    NCTC8325        MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT
    Newman          MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT
    USA300_FPR3757  MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWT
                    ************************************************************

    COL             ETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAA
    N315            ETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAA
    NCTC8325        ETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAA
    Newman          ETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAA
    USA300_FPR3757  ETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAA
                    ************************************************************

    COL             TSSESGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIA
    N315            TSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIA
    NCTC8325        TSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIA
    Newman          TSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIA
    USA300_FPR3757  TSSGSGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIA
                    *** ********************************************************

    COL             LDKMKD
    N315            LDKMKD
    NCTC8325        LDKMKD
    Newman          LDKMKD
    USA300_FPR3757  LDKMKD
                    ******