From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005357000
  • symbol?:
  • description?: rod shape determining protein RodA

      descriptions from strain specific annotations:

    • rod shape determining protein RodA
    • cell cycle protein FtsW
    • cell division protein
    • FtsW/RodA/SpoVE family cell division protein
    • Cell division protein FtsW
    • rodA
    • Cell cycle protein
    • cell cycle family protein
    • Rod shape-determining protein
    • membrane protein
  • strand?: +
  • coordinates?: 5535132..5536334
  • synteny block?: BlockID0041540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2075 (ftsW)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2025 (ftsW)
    08BA02176:
    C248_2095
    11819-97:
    MS7_2100
    71193:
    ST398NM01_2125
    ECT-R 2:
    ECTR2_1940
    ED133:
    SAOV_2125
    ED98:
    SAAV_2138 (ftsW)
    HO 5096 0412:
    SAEMRSA15_19930
    JH1:
    SaurJH1_2159
    JH9:
    SaurJH9_2121
    JKD6008:
    SAA6008_02122
    JKD6159:
    SAA6159_01998
    LGA251:
    SARLGA251_18860
    M013:
    M013TW_2042
    MRSA252:
    SAR2171
    MSHR1132:
    SAMSHR1132_19080
    MSSA476:
    SAS1988
    Mu3:
    SAHV_2069
    Mu50:
    SAV2084
    MW2:
    MW2007
    RF122:
    SAB1968
    ST398:
    SAPIG2125
    T0131:
    SAT0131_02242
    TCH60:
    HMPREF0772_11111 (ftsW)
    TW20:
    SATW20_22230
    USA300_TCH1516:
    USA300HOU_2079
    VC40:
    SAVC_09300

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYSSRQQPDKHWLRKVDWVLVATIAVLAIFSVLLINSAMGGGQYSANFGIRQIFYYILG
    N315            MNYSSRQQPDKHWLRKVDWVLVATIAVLAIFSVLLINSAMGGGQYSANFGIRQIFYYILG
    NCTC8325        MNYSSRQQPDKHWLRKVDWVLVATIAVLAIFSVLLINSAMGGGQYSANFGIRQIFYYILG
    Newman          MNYSSRQQPDKHWLRKVDWVLVATIAVLAIFSVLLINSAMGGGQYSANFGIRQIFYYILG
    USA300_FPR3757  MNYSSRQQPDKHWLRKVDWVLVATIAVLAIFSVLLINSAMGGGQYSANFGIRQIFYYILG
                    ************************************************************

    COL             AIFAGIIMFISPKKIKHYTYLLYFLICLLLIGLLVIPESPITPIINGAKSWYTFGPISIQ
    N315            AIFAGIIMFISPKKIKHYTYLLYFLICLLLIGLLVIPESPITPIINGAKSWYTFGPISIQ
    NCTC8325        AIFAGIIMFISPKKIKHYTYLLYFLICLLLIGLLVIPESPITPIINGAKSWYTFGPISIQ
    Newman          AIFAGIIMFISPKKIKHYTYLLYFLICLLLIGLLVIPESPITPIINGAKSWYTFGPISIQ
    USA300_FPR3757  AIFAGIIMFISPKKIKHYTYLLYFLICLLLIGLLVIPESPITPIINGAKSWYTFGPISIQ
                    ************************************************************

    COL             PSEFMKIILILALARVVSRHNQFTFNKSFQSDLLLFFKIIGVSLVPSILILLQNDLGTTL
    N315            PSEFMKIILILALARVVSRHNQFTFNKSFQSDLLLFFKIIGVSLVPSILILLQNDLGTTL
    NCTC8325        PSEFMKIILILALARVVSRHNQFTFNKSFQSDLLLFFKIIGVSLVPSILILLQNDLGTTL
    Newman          PSEFMKIILILALARVVSRHNQFTFNKSFQSDLLLFFKIIGVSLVPSILILLQNDLGTTL
    USA300_FPR3757  PSEFMKIILILALARVVSRHNQFTFNKSFQSDLLLFFKIIGVSLVPSILILLQNDLGTTL
                    ************************************************************

    COL             VLAAIIAGVMLVSGITWRILAPIFITGIVGAMTVILGILYAPALIENLLGVQLYQMGRIN
    N315            VLAAIIAGVMLVSGITWRILAPIFITGIVGAMTVILGILYAPALIENLLGVQLYQMGRIN
    NCTC8325        VLAAIIAGVMLVSGITWRILAPIFITGIVGAMTVILGILYAPALIENLLGVQLYQMGRIN
    Newman          VLAAIIAGVMLVSGITWRILAPIFITGIVGAMTVILGILYAPALIENLLGVQLYQMGRIN
    USA300_FPR3757  VLAAIIAGVMLVSGITWRILAPIFITGIVGAMTVILGILYAPALIENLLGVQLYQMGRIN
                    ************************************************************

    COL             SWLDPYTYSSGDGYHLTESLKAIGSGQLLGKGYNHGEVYIPENHTDFIFSVIGEELGFIG
    N315            SWLDPYTYSSGDGYHLTESLKAIGSGQLLGKGYNHGEVYIPENHTDFIFSVIGEELGFIG
    NCTC8325        SWLDPYTYSSGDGYHLTESLKAIGSGQLLGKGYNHGEVYIPENHTDFIFSVIGEELGFIG
    Newman          SWLDPYTYSSGDGYHLTESLKAIGSGQLLGKGYNHGEVYIPENHTDFIFSVIGEELGFIG
    USA300_FPR3757  SWLDPYTYSSGDGYHLTESLKAIGSGQLLGKGYNHGEVYIPENHTDFIFSVIGEELGFIG
                    ************************************************************

    COL             SVILILIFLFLIFHLIRLAAKIEDQFNKIFIVGFVTLLVFHILQNIGMTIQLLPITGIPL
    N315            SVILILIFLFLIFHLIRLAAKIEDQFNKIFIVGFVTLLVFHILQNIGMTIQLLPITGIPL
    NCTC8325        SVILILIFLFLIFHLIRLAAKIEDQFNKIFIVGFVTLLVFHILQNIGMTIQLLPITGIPL
    Newman          SVILILIFLFLIFHLIRLAAKIEDQFNKIFIVGFVTLLVFHILQNIGMTIQLLPITGIPL
    USA300_FPR3757  SVILILIFLFLIFHLIRLAAKIEDQFNKIFIVGFVTLLVFHILQNIGMTIQLLPITGIPL
                    ************************************************************

    COL             PFISYGGSALWSMMTGIGIVLSIYYHEPKRYVDLYHPKSN
    N315            PFISYGGSALWSMMTGIGIVLSIYYHEPKRYVDLYHPKSN
    NCTC8325        PFISYGGSALWSMMTGIGIVLSIYYHEPKRYVDLYHPKSN
    Newman          PFISYGGSALWSMMTGIGIVLSIYYHEPKRYVDLYHPKSN
    USA300_FPR3757  PFISYGGSALWSMMTGIGIVLSIYYHEPKRYVDLYHPKSN
                    ****************************************