From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005362000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5538072..5538281
  • synteny block?: BlockID0041590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2027
    08BA02176:
    C248_2097
    11819-97:
    MS7_2102
    71193:
    ST398NM01_2127
    ECT-R 2:
    ECTR2_1942
    ED133:
    SAOV_2127c
    ED98:
    SAAV_2140
    HO 5096 0412:
    SAEMRSA15_19950
    JH1:
    SaurJH1_2161
    JH9:
    SaurJH9_2123
    JKD6008:
    SAA6008_02124
    JKD6159:
    SAA6159_02000
    LGA251:
    SARLGA251_18880
    M013:
    M013TW_2044
    MRSA252:
    SAR2174
    MSHR1132:
    SAMSHR1132_19100
    MSSA476:
    SAS1990
    Mu3:
    SAHV_2071
    Mu50:
    SAV2086
    MW2:
    MW2009
    RF122:
    SAB1970c
    ST398:
    SAPIG2127
    T0131:
    SAT0131_02244
    TCH60:
    HMPREF0772_11107
    TW20:
    SATW20_22250
    USA300_TCH1516:
    USA300HOU_2081
    VC40:
    SAVC_09310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEI
    N315            MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEI
    NCTC8325        MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEI
    Newman          MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEI
    USA300_FPR3757  MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEI
                    ************************************************************

    COL             YDEGYKIVF
    N315            YDEGYKIVF
    NCTC8325        YDEGYKIVF
    Newman          YDEGYKIVF
    USA300_FPR3757  YDEGYKIVF
                    *********