From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005365000
  • symbol?:
  • description?: metal-dependent phosphohydrolase

      descriptions from strain specific annotations:

    • metal-dependent phosphohydrolase
    • HD domain-containing protein
    • metal-dependent phosphohydrolase, HD family
    • HD domain protein
    • Metal dependent hydrolase
  • strand?: +
  • coordinates?: 5540249..5540914
  • synteny block?: BlockID0041620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2030
    08BA02176:
    C248_2100
    11819-97:
    MS7_2105
    71193:
    ST398NM01_2130
    ECT-R 2:
    ECTR2_1945
    ED133:
    SAOV_2130
    ED98:
    SAAV_2143
    HO 5096 0412:
    SAEMRSA15_19980
    JH1:
    SaurJH1_2164
    JH9:
    SaurJH9_2126
    JKD6008:
    SAA6008_02127
    JKD6159:
    SAA6159_02003
    LGA251:
    SARLGA251_18910
    M013:
    M013TW_2047
    MRSA252:
    SAR2178
    MSHR1132:
    SAMSHR1132_19130
    MSSA476:
    SAS1993
    Mu3:
    SAHV_2074
    Mu50:
    SAV2089
    MW2:
    MW2012
    RF122:
    SAB1973
    ST398:
    SAPIG2130
    T0131:
    SAT0131_02247
    TCH60:
    HMPREF0772_11104
    TW20:
    SATW20_22280
    USA300_TCH1516:
    USA300HOU_2084
    VC40:
    SAVC_09325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQQSDVISAAKKYMESIHQNDYTGHDIAHVYRVTALAKSIAENEGVNDTLVIELACLLHD
    N315            MQQSDVISAAKKYMESIHQNDYTGHDIAHVYRVTALAKSIAENEGVNDTLVIELACLLHD
    NCTC8325        MQQSDVISAAKKYMESIHQNDYTGHDIAHVYRVTALAKSIAENEGVNDTLVIELACLLHD
    Newman          MQQSDVISAAKKYMESIHQNDYTGHDIAHVYRVTALAKSIAENEGVNDTLVIELACLLHD
    USA300_FPR3757  MQQSDVISAAKKYMESIHQNDYTGHDIAHVYRVTALAKSIAENEGVNDTLVIELACLLHD
                    ************************************************************

    COL             TVDEKVVDANKQYVELKSFLSSLSLSTEDQEHILFIINNMSYRNGKNDHVTLSLEGQIVR
    N315            TVDEKVVDANKQYVELKSFLSSLSLSTEDQEHILFIINNMSYRNGKNDHVTLSLEGQIVR
    NCTC8325        TVDEKVVDANKQYVELKSFLSSLSLSTEDQEHILFIINNMSYRNGKNDHVTLSLEGQIVR
    Newman          TVDEKVVDANKQYVELKSFLSSLSLSTEDQEHILFIINNMSYRNGKNDHVTLSLEGQIVR
    USA300_FPR3757  TVDEKVVDANKQYVELKSFLSSLSLSTEDQEHILFIINNMSYRNGKNDHVTLSLEGQIVR
                    ************************************************************

    COL             DADRLDAIGAIGVARTFQFAGHFGEPMWTEHMSLDKINDDLVEQLPPSAIKHFFEKLLKL
    N315            DADRLDAIGAIGVARTFQFAGHFGEPMWTEHMSLDKINDDLVEQLPPSAIKHFFEKLLKL
    NCTC8325        DADRLDAIGAIGVARTFQFAGHFGEPMWTEHMSLDKINDDLVEQLPPSAIKHFFEKLLKL
    Newman          DADRLDAIGAIGVARTFQFAGHFGEPMWTEHMSLDKINDDLVEQLPPSAIKHFFEKLLKL
    USA300_FPR3757  DADRLDAIGAIGVARTFQFAGHFGEPMWTEHMSLDKINDDLVEQLPPSAIKHFFEKLLKL
                    ************************************************************

    COL             ESLMHTDTAKMIAKERHDFMMMYLKQFFTEWNCHD
    N315            ESLMHTDTAKMIAKERHDFMMMYLKQFFTEWNYHD
    NCTC8325        ESLMHTDTAKMIAKERHDFMMMYLKQFFTEWNCHD
    Newman          ESLMHTDTAKMIAKERHDFMMMYLKQFFTEWNCHD
    USA300_FPR3757  ESLMHTDTAKMIAKERHDFMMMYLKQFFTEWNCHD
                    ******************************** **