From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005374000
  • symbol?: thiM
  • description?: hydroxyethylthiazole kinase

      descriptions from strain specific annotations:

    • hydroxyethylthiazole kinase
    • hydroxyethylthiazole kinase (4-methyl-5-beta-hydroxyethylthiazole kinase) (Thz kinase) (TH kinase)
    • putative hydroxyethylthiazole kinase
  • strand?: -
  • coordinates?: 5545045..5545845
  • synteny block?: BlockID0041710
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2084 (thiM)
    N315:
    SA1895 (thiM)
    NCTC8325:
    Newman:
    NWMN_1996 (thiM)
    USA300_FPR3757:
    04-02981:
    SA2981_2033 (thiM)
    08BA02176:
    C248_2105 (thiM)
    11819-97:
    MS7_2108 (thiM)
    71193:
    ST398NM01_2135
    ECT-R 2:
    ECTR2_1948
    ED133:
    SAOV_2133c
    ED98:
    SAAV_2146 (thiM)
    HO 5096 0412:
    SAEMRSA15_20010 (thiM)
    JH1:
    SaurJH1_2167
    JH9:
    SaurJH9_2129
    JKD6008:
    SAA6008_02130 (thiM)
    JKD6159:
    SAA6159_02006 (thiM)
    LGA251:
    SARLGA251_18940 (thiM)
    M013:
    M013TW_2050
    MRSA252:
    SAR2181 (thiM)
    MSHR1132:
    SAMSHR1132_19160
    MSSA476:
    SAS1996
    Mu3:
    SAHV_2077 (thiM)
    Mu50:
    SAV2092 (thiM)
    MW2:
    MW2015 (thiM)
    RF122:
    SAB1976c (thiM)
    ST398:
    SAPIG2135
    T0131:
    SAT0131_02252
    TCH60:
    HMPREF0772_11099 (thiM)
    TW20:
    SATW20_22310 (thiM)
    USA300_TCH1516:
    VC40:
    SAVC_09340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYLNKIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINI
    N315            MNYLNKIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINI
    NCTC8325        MNYLNKIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINI
    Newman          MNYLNKIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINI
    USA300_FPR3757  MNYLNKIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINI
                    ************************************************************

    COL             GTLTAENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASE
    N315            GTLTAQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASE
    NCTC8325        GTLTAENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASE
    Newman          GTLTAENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASE
    USA300_FPR3757  GTLTAENEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASE
                    *****:******************************************************

    COL             ILALIDDTATMKGTDSDANLDAVAIAKKAYATYKTAIVITGKEDVIVQDNKAFVLANGSP
    N315            ILALIDDTATMKGTDSDANLDAVAIAKKAYAIYKTAIVITGKEDVIVQDNKAIVLANGSP
    NCTC8325        ILALIDDTATMKGTDSDANLDAVAIAKKAYATYKTAIVITGKEDVIVQDNKAFVLANGSP
    Newman          ILALIDDTATMKGTDSDANLDAVAIAKKAYATYKTAIVITGKEDVIVQDNKAFVLANGSP
    USA300_FPR3757  ILALIDDTATMKGTDSDANLDAVAIAKKAYATYKTAIVITGKEDVIVQDNKAFVLANGSP
                    ******************************* ********************:*******

    COL             LLARVTGAGCLLGGVIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPL
    N315            LLARVTGAGCLLGGVIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPL
    NCTC8325        LLARVTGAGCLLGGVIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPL
    Newman          LLARVTGAGCLLGGVIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPL
    USA300_FPR3757  LLARVTGAGCLLGGVIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPL
                    ************************************************************

    COL             LLDTLYHLNETTYQQRIRIQEVE
    N315            LLDTLYHLNETTYQQRIRIQEVE
    NCTC8325        LLDTLYHLNETTYQQRIRIQEVE
    Newman          LLDTLYHLNETTYQQRIRIQEVE
    USA300_FPR3757  LLDTLYHLNETTYQQRIRIQEVE
                    ***********************