From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005376000
  • symbol?: tenA
  • description?: transcriptional activator TenA

      descriptions from strain specific annotations:

    • transcriptional activator TenA
    • TenA family transcription regulator
    • TENA/THI-4 family protein
    • TENA/THI-4 domain-containing protein
    • transcriptional regulator TenA family protein
    • putative thiaminase-2
    • Thiaminase II
    • TENA/THI-4/PQQC family protein
    • tena/thi-4 family
    • TenA protein
  • strand?: -
  • coordinates?: 5546652..5547342
  • synteny block?: BlockID0041730
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2035 (tenA)
    08BA02176:
    C248_2107 (tenA)
    11819-97:
    MS7_2110 (tenA)
    71193:
    ST398NM01_2137
    ECT-R 2:
    ECTR2_1950
    ED133:
    SAOV_2135c (tenA)
    ED98:
    SAAV_2148
    HO 5096 0412:
    SAEMRSA15_20030 (tenA)
    JH1:
    SaurJH1_2169
    JH9:
    SaurJH9_2131
    JKD6008:
    SAA6008_02132 (tenA)
    JKD6159:
    SAA6159_02008 (tenA)
    LGA251:
    SARLGA251_18960 (tenA)
    M013:
    M013TW_2052
    MRSA252:
    SAR2183 (tenA)
    MSHR1132:
    SAMSHR1132_19180
    MSSA476:
    SAS1998
    Mu3:
    SAHV_2079
    Mu50:
    SAV2094
    MW2:
    MW2017
    RF122:
    SAB1978c (tenA)
    ST398:
    SAPIG2137
    T0131:
    SAT0131_02254
    TCH60:
    HMPREF0772_11097 (tenA)
    TW20:
    SATW20_22330 (tenA)
    USA300_TCH1516:
    VC40:
    SAVC_09350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIP
    N315            MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIP
    NCTC8325        MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIP
    Newman          MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIP
    USA300_FPR3757  MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIP
                    ************************************************************

    COL             KMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQ
    N315            KMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQ
    NCTC8325        KMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQ
    Newman          KMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQ
    USA300_FPR3757  KMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQ
                    ************************************************************

    COL             AHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEA
    N315            AHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEA
    NCTC8325        AHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEA
    Newman          AHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEA
    USA300_FPR3757  AHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEA
                    ************************************************************

    COL             LMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND
    N315            LMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND
    NCTC8325        IMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND
    Newman          LMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND
    USA300_FPR3757  LMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND
                    :************************************************