From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005393000
  • symbol?: atpC
  • description?: F0F1 ATP synthase subunit epsilon

      descriptions from strain specific annotations:

    • F0F1 ATP synthase subunit epsilon
    • ATP synthase epsilon chain
    • ATP synthase F0F1 subunit epsilon
    • ATP synthase epsilon chain, AtpE
    • ATP synthase F1, epsilon subunit
    • ATP synthase F1 sector epsilon subunit
    • ATP synthase F1 subunit epsilon
  • strand?: -
  • coordinates?: 5555620..5556024
  • synteny block?: BlockID0041890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2094 (atpC)
    N315:
    SA1904 (atpC)
    NCTC8325:
    Newman:
    NWMN_2006 (atpC)
    USA300_FPR3757:
    04-02981:
    SA2981_2042 (atpC)
    08BA02176:
    C248_2116 (atpC)
    11819-97:
    MS7_2118 (atpC)
    71193:
    ST398NM01_2144
    ECT-R 2:
    ECTR2_1958 (atpC)
    ED133:
    SAOV_2143c
    ED98:
    SAAV_2157 (atpC)
    HO 5096 0412:
    SAEMRSA15_20100 (atpC)
    JH1:
    SaurJH1_2176 (atpC)
    JH9:
    SaurJH9_2138 (atpC)
    JKD6008:
    SAA6008_02140 (atpE)
    JKD6159:
    SAA6159_02016 (atpE)
    LGA251:
    SARLGA251_19030 (atpC)
    M013:
    M013TW_2061
    MRSA252:
    SAR2190 (atpC)
    MSHR1132:
    SAMSHR1132_19250
    MSSA476:
    SAS2005 (atpC)
    Mu3:
    SAHV_2086 (atpC)
    Mu50:
    SAV2102 (atpC)
    MW2:
    MW2026 (atpC)
    RF122:
    SAB1986c (atpC)
    ST398:
    SAPIG2144 (atpC)
    T0131:
    SAT0131_02263
    TCH60:
    HMPREF0772_11089 (atpC)
    TW20:
    SATW20_22400 (atpC)
    USA300_TCH1516:
    USA300HOU_2092 (atpC)
    VC40:
    SAVC_09385 (atpC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTE
    N315            MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTE
    NCTC8325        MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTE
    Newman          MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTE
    USA300_FPR3757  MNTLNLDIVTPNGSVYNRDNVELVVMQTTAGEIGVMSGHIPTVAALKTGFVKVKFHDGTE
                    ************************************************************

    COL             YIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERA
    N315            YIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERA
    NCTC8325        YIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERA
    Newman          YIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERA
    USA300_FPR3757  YIAVSDGFVEVRKDKVSIIVQTAETAREIDVERAKLAKARAESHLENDDDNTDIHRAERA
                    ************************************************************

    COL             LERANNRLRVAELK
    N315            LERANNRLRVAELK
    NCTC8325        LERANNRLRVAELK
    Newman          LERANNRLRVAELK
    USA300_FPR3757  LERANNRLRVAELK
                    **************