From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005394000
  • symbol?: atpD
  • description?: F0F1 ATP synthase subunit beta

      descriptions from strain specific annotations:

    • F0F1 ATP synthase subunit beta
    • ATP synthase subunit beta
    • ATP synthase F0F1 subunit beta
    • ATP synthase beta chain
    • ATP synthase F1, beta subunit
    • ATP synthase F1 sector beta subunit
    • ATP synthase F1 subunit beta
    • ATP synthase subunit beta, AtpB
  • strand?: -
  • coordinates?: 5556044..5557456
  • synteny block?: BlockID0041900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2095 (atpD)
    N315:
    SA1905 (atpD)
    NCTC8325:
    Newman:
    NWMN_2007 (atpD)
    USA300_FPR3757:
    04-02981:
    SA2981_2043 (atpD)
    08BA02176:
    C248_2117 (atpD)
    11819-97:
    MS7_2119 (atpD)
    71193:
    ST398NM01_2145
    ECT-R 2:
    ECTR2_1959 (atpD)
    ED133:
    SAOV_2144c
    ED98:
    SAAV_2158 (atpD)
    HO 5096 0412:
    SAEMRSA15_20110 (atpD)
    JH1:
    SaurJH1_2177
    JH9:
    SaurJH9_2139
    JKD6008:
    SAA6008_02141 (atpB)
    JKD6159:
    SAA6159_02017 (atpB)
    LGA251:
    SARLGA251_19040 (atpD)
    M013:
    M013TW_2062
    MRSA252:
    SAR2191 (atpD)
    MSHR1132:
    SAMSHR1132_19260
    MSSA476:
    SAS2006
    Mu3:
    SAHV_2087 (atpD)
    Mu50:
    SAV2103 (atpD)
    MW2:
    MW2027 (atpD)
    RF122:
    SAB1987c (atpD)
    ST398:
    SAPIG2145 (atpD)
    T0131:
    SAT0131_02264
    TCH60:
    HMPREF0772_11088 (atpD)
    TW20:
    SATW20_22410 (atpD)
    USA300_TCH1516:
    USA300HOU_2093 (atpD)
    VC40:
    SAVC_09390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGIGRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIA
    N315            MGIGRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIA
    NCTC8325        MGIGRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIA
    Newman          MGIGRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIA
    USA300_FPR3757  MGIGRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIA
                    ************************************************************

    COL             MDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAP
    N315            MDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAP
    NCTC8325        MDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAP
    Newman          MDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAP
    USA300_FPR3757  MDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAP
                    ************************************************************

    COL             AFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGIS
    N315            AFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGIS
    NCTC8325        AFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGIS
    Newman          AFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGIS
    USA300_FPR3757  AFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGIS
                    ************************************************************

    COL             VFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQ
    N315            VFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQ
    NCTC8325        VFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQ
    Newman          VFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQ
    USA300_FPR3757  VFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQ
                    ************************************************************

    COL             GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSI
    N315            GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSI
    NCTC8325        GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSI
    Newman          GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSI
    USA300_FPR3757  GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSI
                    ************************************************************

    COL             QAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEH
    N315            QAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEH
    NCTC8325        QAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEH
    Newman          QAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEH
    USA300_FPR3757  QAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEH
                    ************************************************************

    COL             YEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQ
    N315            YEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQ
    NCTC8325        YEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQ
    Newman          YEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQ
    USA300_FPR3757  YEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQ
                    ************************************************************

    COL             KGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDMGVEV
    N315            KGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDMGVEV
    NCTC8325        KGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDMGVEV
    Newman          KGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDMGVEV
    USA300_FPR3757  KGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDVIAKAKDMGVEV
                    **************************************************