From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005398000
  • symbol?: atpF
  • description?: F0F1 ATP synthase subunit B

      descriptions from strain specific annotations:

    • F0F1 ATP synthase subunit B
    • ATP synthase subunit B
    • ATP synthase F0F1 subunit B
    • ATP synthase B chain
    • ATP synthase F0, B subunit
    • ATP synthase F0 subunit B
    • ATP synthase subunit beta, AtpB_1
    • putative ATP synthase subunit b
  • strand?: -
  • coordinates?: 5560444..5560965
  • synteny block?: BlockID0041940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2099 (atpF)
    N315:
    SA1909 (atpF)
    NCTC8325:
    Newman:
    NWMN_2011 (atpF)
    USA300_FPR3757:
    04-02981:
    SA2981_2047 (atpF)
    08BA02176:
    C248_2121 (atpF)
    11819-97:
    MS7_2123 (atpF)
    71193:
    ST398NM01_2149
    ECT-R 2:
    ECTR2_1963 (atpF)
    ED133:
    SAOV_2148c
    ED98:
    SAAV_2162 (atpF)
    HO 5096 0412:
    SAEMRSA15_20150 (atpF)
    JH1:
    SaurJH1_2181
    JH9:
    SaurJH9_2143
    JKD6008:
    SAA6008_02145 (atpB_1)
    JKD6159:
    SAA6159_02021 (atpB_1)
    LGA251:
    SARLGA251_19080 (atpF)
    M013:
    M013TW_2066
    MRSA252:
    SAR2195 (atpF)
    MSHR1132:
    SAMSHR1132_19300
    MSSA476:
    SAS2010
    Mu3:
    SAHV_2091 (atpF)
    Mu50:
    SAV2107 (atpF)
    MW2:
    MW2031 (atpF)
    RF122:
    SAB1991c (atpF)
    ST398:
    SAPIG2149 (atpF)
    T0131:
    SAT0131_02269 (oppC)
    TCH60:
    HMPREF0772_11084 (atpF)
    TW20:
    SATW20_22450 (atpF)
    USA300_TCH1516:
    USA300HOU_2097 (atpF)
    VC40:
    SAVC_09410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD
    N315            MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD
    NCTC8325        MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD
    Newman          MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD
    USA300_FPR3757  MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD
                    ************************************************************

    COL             AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ
    N315            AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ
    NCTC8325        AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ
    Newman          AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ
    USA300_FPR3757  AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ
                    ************************************************************

    COL             SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK
    N315            SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK
    NCTC8325        SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK
    Newman          SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK
    USA300_FPR3757  SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK
                    *****************************************************