From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005400000
  • symbol?: atpB
  • description?: F0F1 ATP synthase subunit A

      descriptions from strain specific annotations:

    • F0F1 ATP synthase subunit A
    • ATP synthase subunit A
    • ATP synthase F0F1 subunit A
    • ATP synthase A chain
    • ATP synthase F0, A subunit
    • ATP synthase F0 subunit A
    • ATP synthase subunit alpha, AtpA_1
  • strand?: -
  • coordinates?: 5561422..5562150
  • synteny block?: BlockID0041960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2101 (atpB)
    N315:
    SA1911 (atpB)
    NCTC8325:
    Newman:
    NWMN_2013 (atpB)
    USA300_FPR3757:
    04-02981:
    SA2981_2049 (atpB)
    08BA02176:
    C248_2123 (atpB)
    11819-97:
    MS7_2125 (atpB)
    71193:
    ST398NM01_2151
    ECT-R 2:
    ECTR2_1965 (atpB)
    ED133:
    SAOV_2150c
    ED98:
    SAAV_2164 (atpB)
    HO 5096 0412:
    SAEMRSA15_20170 (atpB)
    JH1:
    SaurJH1_2183
    JH9:
    SaurJH9_2145
    JKD6008:
    SAA6008_02147 (atpA_1)
    JKD6159:
    SAA6159_02023 (atpA_1)
    LGA251:
    SARLGA251_19100 (atpB)
    M013:
    M013TW_2068
    MRSA252:
    SAR2197 (atpB)
    MSHR1132:
    SAMSHR1132_19320
    MSSA476:
    SAS2012
    Mu3:
    SAHV_2093 (atpB)
    Mu50:
    SAV2109 (atpB)
    MW2:
    MW2033 (atpB)
    RF122:
    SAB1993c (atpB)
    ST398:
    SAPIG2151 (atpB)
    T0131:
    SAT0131_02271 (oppF)
    TCH60:
    HMPREF0772_11082 (atpB)
    TW20:
    SATW20_22470 (atpB)
    USA300_TCH1516:
    USA300HOU_2099 (atpB)
    VC40:
    SAVC_09420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF
    N315            MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF
    NCTC8325        MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF
    Newman          MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF
    USA300_FPR3757  MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF
                    ************************************************************

    COL             DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV
    N315            DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV
    NCTC8325        DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV
    Newman          DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV
    USA300_FPR3757  DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV
                    ************************************************************

    COL             TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF
    N315            TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF
    NCTC8325        TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF
    Newman          TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF
    USA300_FPR3757  TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF
                    ************************************************************

    COL             AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD
    N315            AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD
    NCTC8325        AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD
    Newman          AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD
    USA300_FPR3757  AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD
                    ************************************************************

    COL             EH
    N315            EH
    NCTC8325        EH
    Newman          EH
    USA300_FPR3757  EH
                    **