From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005409000
  • symbol?: prfA
  • description?: peptide chain release factor 1

      descriptions from strain specific annotations:

    • peptide chain release factor 1
    • peptide chain release factor RF1
    • peptide chain release factor 1 (RF-1)
  • strand?: -
  • coordinates?: 5568800..5569876
  • synteny block?: BlockID0042050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2110 (prfA)
    N315:
    SA1920 (prfA)
    NCTC8325:
    Newman:
    NWMN_2022 (prfA)
    USA300_FPR3757:
    04-02981:
    SA2981_2058 (prfA)
    08BA02176:
    C248_2132 (prfA)
    11819-97:
    MS7_2134 (prfA)
    71193:
    ST398NM01_2160
    ECT-R 2:
    ECTR2_1974 (prfA)
    ED133:
    SAOV_2159c (prfA)
    ED98:
    SAAV_2173 (prfA)
    HO 5096 0412:
    SAEMRSA15_20260 (prfA)
    JH1:
    SaurJH1_2192 (prfA)
    JH9:
    SaurJH9_2154 (prfA)
    JKD6008:
    SAA6008_02156 (prfA)
    JKD6159:
    SAA6159_02032 (prfA)
    LGA251:
    SARLGA251_19190 (prfA)
    M013:
    M013TW_2077
    MRSA252:
    SAR2206 (prfA)
    MSHR1132:
    SAMSHR1132_19410
    MSSA476:
    SAS2021 (prfA)
    Mu3:
    SAHV_2102 (prfA)
    Mu50:
    SAV2118 (prfA)
    MW2:
    MW2042 (prfA)
    RF122:
    SAB2002c (prfA)
    ST398:
    SAPIG2160 (prfA)
    T0131:
    SAT0131_02281 (trpS)
    TCH60:
    HMPREF0772_11073 (prfA)
    TW20:
    SATW20_22560 (prfA)
    USA300_TCH1516:
    USA300HOU_2106 (prfA)
    VC40:
    SAVC_09465 (prfA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELAD
    N315            MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELAD
    NCTC8325        MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELAD
    Newman          MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELAD
    USA300_FPR3757  MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELAD
                    ************************************************************

    COL             IEEMLSETDDKEEVEMLKEESNGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGG
    N315            IEEMLSETDDKEEVEMLKEESNGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGG
    NCTC8325        IEEMLSETDDKEEVEMLKEESNGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGG
    Newman          IEEMLSETDDKEEVEMLKEESNGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGG
    USA300_FPR3757  IEEMLSETDDKEEVEMLKEESNGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGG
                    ************************************************************

    COL             DEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGA
    N315            DEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGA
    NCTC8325        DEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGA
    Newman          DEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGA
    USA300_FPR3757  DEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGA
                    ************************************************************

    COL             HRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDS
    N315            HRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDS
    NCTC8325        HRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDS
    Newman          HRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDS
    USA300_FPR3757  HRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDS
                    ************************************************************

    COL             AVRITHLPTGVIATSSEKSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDR
    N315            AVRITHLPTGVIATSSEKSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDR
    NCTC8325        AVRITHLPTGVIATSSEKSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDR
    Newman          AVRITHLPTGVIATSSEKSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDR
    USA300_FPR3757  AVRITHLPTGVIATSSEKSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDR
                    ************************************************************

    COL             SERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKELNNGEL
    N315            SERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKELNNGEL
    NCTC8325        SERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKELNNGEL
    Newman          SERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKELNNGEL
    USA300_FPR3757  SERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKELNNGEL
                    **********************************************************