From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005422000
  • symbol?: rpoE
  • description?: DNA-directed RNA polymerase subunit delta

      descriptions from strain specific annotations:

    • DNA-directed RNA polymerase subunit delta
    • DNA-directed RNA polymerase, delta subunit
    • DNA-directed RNA polymerase delta subunit
    • DNA-directed RNA polymerase sigma subunit RpoE
  • strand?: -
  • coordinates?: 5582513..5583043
  • synteny block?: BlockID0042170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2120 (rpoE)
    N315:
    SA1930 (rpoE)
    NCTC8325:
    Newman:
    NWMN_2032 (rpoE)
    USA300_FPR3757:
    04-02981:
    SA2981_2068 (rpoE)
    08BA02176:
    C248_2142 (rpoE)
    11819-97:
    MS7_2146
    71193:
    ST398NM01_2170
    ECT-R 2:
    ECTR2_1984
    ED133:
    SAOV_2169c (rpoE)
    ED98:
    SAAV_2183 (rpoE)
    HO 5096 0412:
    SAEMRSA15_20360 (rpoE)
    JH1:
    SaurJH1_2202
    JH9:
    SaurJH9_2164
    JKD6008:
    SAA6008_02166 (rpoE)
    JKD6159:
    SAA6159_02042 (rpoE)
    LGA251:
    SARLGA251_19290 (rpoE)
    M013:
    M013TW_2087
    MRSA252:
    SAR2216 (rpoE)
    MSHR1132:
    SAMSHR1132_19510
    MSSA476:
    SAS2031
    Mu3:
    SAHV_2112 (rpoE)
    Mu50:
    SAV2128 (rpoE)
    MW2:
    MW2052 (rpoE)
    RF122:
    SAB2012c (rpoE)
    ST398:
    SAPIG2170 (rpoE)
    T0131:
    SAT0131_02292
    TCH60:
    HMPREF0772_11062 (rpoE)
    TW20:
    SATW20_22660 (rpoE)
    USA300_TCH1516:
    USA300HOU_2116 (rpoE2)
    VC40:
    SAVC_09515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYT
    N315            MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYT
    NCTC8325        MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYT
    Newman          MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYT
    USA300_FPR3757  MKIQDYTKQMVDEKSFIDMAYTLLNDKGETMNLYDIIDEFRALGDYEYEEIENRVVQFYT
                    ************************************************************

    COL             DLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMD
    N315            DLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMD
    NCTC8325        DLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMD
    Newman          DLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMD
    USA300_FPR3757  DLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDILDADDEEDQNLKLLGEDEMD
                    ************************************************************

    COL             DDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
    N315            DDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
    NCTC8325        DDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
    Newman          DDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
    USA300_FPR3757  DDDDIPAQTDDQEELNDPEDEQVEEEINHSDIVIEEDEDELDEDEEVFEDEEDFND
                    ********************************************************