From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005429000
  • symbol?: hmrA
  • description?: aminobenzoyl-glutamate utilization protein B

      descriptions from strain specific annotations:

    • aminobenzoyl-glutamate utilization protein B
    • M20/M25/M40 family peptidase
    • amidohydrolase
    • putative peptidase
    • HmrA protein
    • amidohydrolase family protein
    • HmrA protein ,methicillin resistance, amidohydrolase of M40 family
    • HmrA protein involved in methicillin resistance / amidohydrolase of M40 family
    • M20D subfamily peptidase
    • peptidase, M20/M25/M40 family
    • putative amidase
  • strand?: -
  • coordinates?: 5587997..5589181
  • synteny block?: BlockID0042240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1935 (hmrA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2073 (hmrA)
    08BA02176:
    C248_2148
    11819-97:
    MS7_2151 (hmrA)
    71193:
    ST398NM01_2175
    ECT-R 2:
    ECTR2_1989
    ED133:
    SAOV_2174c
    ED98:
    SAAV_2188
    HO 5096 0412:
    SAEMRSA15_20410
    JH1:
    SaurJH1_2207
    JH9:
    SaurJH9_2169
    JKD6008:
    SAA6008_02172 (hmrA)
    JKD6159:
    SAA6159_02047 (hmrA)
    LGA251:
    SARLGA251_19340
    M013:
    M013TW_2092
    MRSA252:
    SAR2221
    MSHR1132:
    SAMSHR1132_19560
    MSSA476:
    SAS2036
    Mu3:
    SAHV_2117 (hmrA)
    Mu50:
    SAV2133 (hmrA)
    MW2:
    MW2057 (hmrA)
    RF122:
    SAB2017c
    ST398:
    SAPIG2175
    T0131:
    SAT0131_02297
    TCH60:
    HMPREF0772_11057 (hmrA)
    TW20:
    SATW20_22710
    USA300_TCH1516:
    USA300HOU_2122 (hmrA)
    VC40:
    SAVC_09540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEKQQILDYIETNKYSYIEISHRIHERPELGNEEIFASRTLIDRLKEHDFEIETEIAGH
    N315            MSEKQQILDYIETNKYSYIEISHRIHERPELGNEEIFASRTLIDRLKEHDFEIETEIAGH
    NCTC8325        MSEKQQILDYIETNKYSYIEISHRIHERPELGNEEIFASRTLIDRLKEHDFEIETEIAGH
    Newman          MSEKQQILDYIETNKYSYIEISHRIHERPELGNEEIFASRTLIDRLKEHDFEIETEIAGH
    USA300_FPR3757  MSEKQQILDYIETNKYSYIEISHRIHERPELGNEEIFASRTLIDRLKEHDFEIETEIAGH
                    ************************************************************

    COL             ATGFIATYDSGLDGPAIGFLAEYDALPGLGHACGHNIIGTASVLGAIGLKQVIDQIGGKV
    N315            ATGFIATYDSGLDGPAIGFLAEYDALPGLGHACGHNIIGTASVLGAIGLKQVIDQIGGKV
    NCTC8325        ATGFIATYDSGLDGPAIGFLAEYDALPGLGHACGHNIIGTASVLGAIGLKQVIDQIGGKV
    Newman          ATGFIATYDSGLDGPAIGFLAEYDALPGLGHACGHNIIGTASVLGAIGLKQVIDQIGGKV
    USA300_FPR3757  ATGFIATYDSGLDGPAIGFLAEYDALPGLGHACGHNIIGTASVLGAIGLKQVIDQIGGKV
                    ************************************************************

    COL             VVLGCPAEEGGENGSAKASYVKAGVIDQIDIALMIHPGNETYKTIDTLAVDVLDVKFYGK
    N315            VVLGCPAEEGGENGSAKASYVKAGVIDQIDIALMIHPGNETYKTIDTLAVDVLDVKFYGK
    NCTC8325        VVLGCPAEEGGENGSAKASYVKAGVIDQIDIALMIHPGNETYKTIDTLAVDVLDVKFYGK
    Newman          VVLGCPAEEGGENGSAKASYVKAGVIDQIDIALMIHPGNETYKTIDTLAVDVLDVKFYGK
    USA300_FPR3757  VVLGCPAEEGGENGSAKASYVKAGVIDQIDIALMIHPGNETYKTIDTLAVDVLDVKFYGK
                    ************************************************************

    COL             SAHASENADEALNALDAMISYFNGVAQLRQHIKKDQRVHGVILDGGKAANIIPDYTHARF
    N315            SAHASENADEALNALDAMISYFNGVAQLRQHIKKDQRVHGVILDGGKAANIIPDYTHARF
    NCTC8325        SAHASENADEALNALDAMISYFNGVAQLRQHIKKDQRVHGVILDGGKAANIIPDYTHARF
    Newman          SAHASENADEALNALDAMISYFNGVAQLRQHIKKDQRVHGVILDGGKAANIIPDYTHARF
    USA300_FPR3757  SAHASENADEALNALDAMISYFNGVAQLRQHIKKDQRVHGVILDGGKAANIIPDYTHARF
                    ************************************************************

    COL             YTRAMTRKELDILTEKVNQIARGAAIQTGCDYEFGRIQNGVNEFIKTPKLDDLFAKYAEE
    N315            YTRAMTRKELDILTEKVNQIARGAAIQTGCDYEFGPIQNGVNEFIKTPKLDDLFAKYAEE
    NCTC8325        YTRAMTRKELDILTEKVNQIARGAAIQTGCDYEFGRIQNGVNEFIKTPKLDDLFAKYAEE
    Newman          YTRAMTRKELDILTEKVNQIARGAAIQTGCDYEFGRIQNGVNEFIKTPKLDDLFAKYAEE
    USA300_FPR3757  YTRAMTRKELDILTEKVNQIARGAAIQTGCDYEFGRIQNGVNEFIKTPKLDDLFAKYAEE
                    *********************************** ************************

    COL             VGEAVIDDDFGYGSTDTGNVSHVVPTIHPHIKIGSRNLVGHTHRFREAAASVHGDEALIK
    N315            VGEAVIDDDFGYGSTDTGNVSHVVPTIHPHIKIGSRNLVGHTHRFREAAASVHGDEALIK
    NCTC8325        VGEAVIDDDFGYGSTDTGNVSHVVPTIHPHIKIGSRNLVGHTHRFREAAASVHGDEALIK
    Newman          VGEAVIDDDFGYGSTDTGNVSHVVPTIHPHIKIGSRNLVGHTHRFREAAASVHGDEALIK
    USA300_FPR3757  VGEAVIDDDFGYGSTDTGNVSHVVPTIHPHIKIGSRNLVGHTHRFREAAASVHGDEALIK
                    ************************************************************

    COL             GAKIMALMGLELITNQDVYQDIIEEHAHLKGNGK
    N315            GAKIMALMGLELITNQDVYQDIIEEHAHLKGNGK
    NCTC8325        GAKIMALMGLELITNQDVYQDIIEEHAHLKGNGK
    Newman          GAKIMALMGLELITNQDVYQDIIEEHAHLKGNGK
    USA300_FPR3757  GAKIMALMGLELITNQDVYQDIIEEHAHLKGNGK
                    **********************************