Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005444000
  • symbol?: czrB
  • description?: Cobalt-zinc-cadmium resistance protein

      descriptions from strain specific annotations:

    • Cobalt-zinc-cadmium resistance protein
    • zinc transporter ZitB
    • zinc resistance protein
    • cation-efflux system membrane protein
    • cation efflux family protein
    • cation diffusion facilitator family transporter
    • CDF family cation diffusion facilitator
    • Zn(II) and Co(II) transmembrane diffusion facilitator
    • cadmium, cobalt and zinc/H(+)-K(+) antiporter
  • strand?: +
  • coordinates?: 5601720..5602712
  • synteny block?: BlockID0042390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1948 (czrB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2086 (czrB)
    08BA02176:
    C248_2161 (czrB)
    11819-97:
    MS7_2164 (czcD)
    71193:
    ST398NM01_2188
    ECT-R 2:
    ECTR2_2002
    ED133:
    SAOV_2185
    ED98:
    SAAV_2201
    HO 5096 0412:
    SAEMRSA15_20540 (czrB)
    JH1:
    SaurJH1_2220
    JH9:
    SaurJH9_2182
    JKD6008:
    SAA6008_02185 (czrB)
    JKD6159:
    SAA6159_02060 (czrB)
    LGA251:
    SARLGA251_19470 (czrB)
    M013:
    M013TW_2106
    MRSA252:
    SAR2234 (czrB)
    MSHR1132:
    SAMSHR1132_19690
    MSSA476:
    SAS2049
    Mu3:
    SAHV_2130 (czrB)
    Mu50:
    SAV2146 (czrB)
    MW2:
    MW2070 (czrB)
    RF122:
    SAB2030 (czrB)
    ST398:
    SAPIG2188
    T0131:
    SAT0131_02311
    TCH60:
    HMPREF0772_11044 (zitB)
    TW20:
    SATW20_22840 (czrB)
    USA300_TCH1516:
    USA300HOU_2135 (czrB)
    VC40:
    SAVC_09610

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSHSHHHHDHMHSHVTTNNKKVLFISFLIIGLYMFIEIIGGLLANSLALLSDGIHMFSDT
    N315            MSHS-HHHDHMHSHVTTNNKKVLFISFLIIGLYMFIEIIGGLLANSLALLSDGIHMFSDT
    NCTC8325        MSHSHHHHDHMHSHVTTNNKKVLFISFLIIGLYMFIEIIGGLLANSLALLSDGIHMFSDT
    Newman          MSHSHHHHDHMHSHVTTNNKKVLFISFLIIGLYMFIEIIGGLLANSLALLSDGIHMFSDT
    USA300_FPR3757  MSHSHHHHDHMHSHVTTNNKKVLFISFLIIGLYMFIEIIGGLLANSLALLSDGIHMFSDT
                    **** *******************************************************

    COL             FSLGVALVAFIYAEKNATTTKTFGYKRFEVLAALFNGVTLFVISILIVFEAIKRFFVPSE
    N315            FSLGVALVAFIYAEKNATTTKTFGYKRFEVLAALFNGVTLFVISILIVFEAIKRFFVPSE
    NCTC8325        FSLGVALVAFIYAEKNATTTKTFGYKRFEVLAALFNGVTLFVISILIVFEAIKRFFVPSE
    Newman          FSLGVALVAFIYAEKNATTTKTFGYKRFEVLAALFNGVTLFVISILIVFEAIKRFFVPSE
    USA300_FPR3757  FSLGVALVAFIYAEKNATTTKTFGYKRFEVLAALFNGVTLFVISILIVFEAIKRFFVPSE
                    ************************************************************

    COL             VQSKEMLIISIIGLIVNIVVAFFMFKGGDTSHNLNMRGAFLHVIGDLLGSVGAITAAILI
    N315            VQSKEMLIISIIGLIVNIVVAFFMFKGGDTSHNLNMRGAFLHVIGDLLGSVGAITAAILI
    NCTC8325        VQSKEMLIISIIGLIVNIVVAFFMFKGGDTSHNLNMRGAFLHVIGDLLGSVGAITAAILI
    Newman          VQSKEMLIISIIGLIVNIVVAFFMFKGGDTSHNLNMRGAFLHVIGDLLGSVGAITAAILI
    USA300_FPR3757  VQSKEMLIISIIGLIVNIVVAFFMFKGGDTSHNLNMRGAFLHVIGDLLGSVGAITAAILI
                    ************************************************************

    COL             WAFGWTIADPIASILVSVIILKSAWGITKSSINILMEGTPSDVDIDEVITTIKKDSRIQS
    N315            WAFGWTIADPIASILVSVIILKSAWGITKSSINILMEGTPSDVDIDEVITTIKKDSRIQS
    NCTC8325        WAFGWTIADPIASILVSVIILKSAWGITKSSINILMEGTPSDVDIDEVITTIKKDSRIQS
    Newman          WAFGWTIADPIASILVSVIILKSAWGITKSSINILMEGTPSDVDIDEVITTIKKDSRIQS
    USA300_FPR3757  WAFGWTIADPIASILVSVIILKSAWGITKSSINILMEGTPSDVDIDEVITTIKKDSRIQS
                    ************************************************************

    COL             VHDCHVWTISNDMNALSCHVVVDHTLTMKECELLLENIEHDLLHLNIHHMTIQLETPNHK
    N315            VHDCHVWTISNDMNALSCHVVVDHTLTMKECELLLENIEHDLLHLNIHHMTIQLETPNHK
    NCTC8325        VHDCHVWTISNDMNALSCHVVVDHTLTMKECELLLENIEHDLLHLNIHHMTIQLETPNHK
    Newman          VHDCHVWTISNDMNALSCHVVVDHTLTMKECELLLENIEHDLLHLNIHHMTIQLETPNHK
    USA300_FPR3757  VHDCHVWTISNDMNALSCHVVVDHTLTMKECELLLENIEHDLLHLNIHHMTIQLETPNHK
                    ************************************************************

    COL             HDESIICSGTHSHSHNHHAHHHAHVH
    N315            HDESIICSGTHSHSHNHHAHHHAHVH
    NCTC8325        HDESIICSGTHSHSHNHHAHHHAHVH
    Newman          HDESIICSGTHSHSHNHHAHHHAHVH
    USA300_FPR3757  HDESIICSGTHSHSHNHHAHHHAHVH
                    **************************