From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005459000
  • symbol?:
  • description?: SAP domain-containing protein

      descriptions from strain specific annotations:

    • SAP domain-containing protein
    • pseudogene
    • putative DNA/RNA binding protein
    • SAP domain protein
  • strand?: -
  • coordinates?: 5614563..5615285
  • synteny block?: BlockID0042480
  • occurrence?: in 34% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    SAOV_2188c
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_02188
    JKD6159:
    LGA251:
    M013:
    M013TW_2109
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02314 (prfC)
    TCH60:
    TW20:
    SATW20_22870
    USA300_TCH1516:
    USA300HOU_2140
    VC40:
    SAVC_09625

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSVNARDLLVLHTNVNRLVGEEIFANKCLANNDVQIMNSIKKLIEAELLTTTNDFEVSIY
    NCTC8325        MSVNARDLLVLHTNVNRLVGEEIFANKCLANNDVQIMNSIKKLIEAELLTTTNDFEVSIY
    Newman          MSVNARDLLVLHTNVNRLVGEEIFANKCLANNDVQIMNSIKKLIEAELLTTTNDFEVSIY
    USA300_FPR3757  MSVNARDLLVLHTNVNRLVGEEIFANKCLANNDVQIMNSIKKLIEAELLTTTNDFEVSIY
                    ************************************************************

    COL             KKTRPELQSILKSFGIKTTGNKPDLIKRIDDNFHIINNLDLPYVYIPTKKGEEILKKTEY
    NCTC8325        KKTRPELQSILKSFGIKTTGNKPDLIKRIDDNFHIINNLDLPYVYIPIKKGEEILKKTEY
    Newman          KKTRPELQSILKSFGIKTTGNKPDLIKRIDDNFHIINNLDLPYVYIPTKKGEEILKKTEY
    USA300_FPR3757  KKTRPELQSILKSFGIKTTGNKPDLIKRIDDNFHIINNLDLPYVYIPTKKGEEILKKTEY
                    *********************************************** ************

    COL             LTSFIQSYGEISLERAYYLVENYIDENCDDKVAEIYKFEFQRKYDNGEFDFNHGYNFELN
    NCTC8325        LTSFIQSYGEISLERAYYLVENYIDENCDDKVAEIYKFEFQRKYDNGEFDFNHGYNFELN
    Newman          LTSFIQSYGEISLERAYYLVENYIDENCDDKVAEIYKFEFQRKYDNGEFDFNHGYNFELN
    USA300_FPR3757  LTSFIQSYGEISLERAYYLVENYIDENCDDKVAEIYKFEFQRKYDNGEFDFNHGYNFELN
                    ************************************************************

    COL             MLIDHYKRDVKDYDNARKYSNIYLYFGLRDFLKKLMSNYSYYDSKGNIDLNEIQNDLNRF
    NCTC8325        MLIDHYKRDVKDYDNARKYSNIYLYFGLRDFLKKLMSNYSYYDSKGNIDLNEIQNDLNRF
    Newman          MLIDHYKRDVKDYDNARKYSNIYLYFGLRDFLKKLMSNYSYYDSKGNIDLNEIQNDLNRF
    USA300_FPR3757  MLIDHYKRDVKDYDNARKYSNIYLYFGLRDFLKKLMSNYSYYDSKGNIDLNEIQNDLNRF
                    ************************************************************

    COL             INSSASGMYERLIYNENLSNNIMFELFKKDTQDYSDLEEQLIEKFINYVVSNVKKESRSN
    NCTC8325        INSSASGMYERLIYNENLSNNIMFELFKKDTQDYSDLEEQLIEKFINYVVSNVKKESRSN
    Newman          INSSASGMYERLIYNENLSNNIMFELFKKDTQDYSDLEEQLIEKFINYVVSNVKKESRSN
    USA300_FPR3757  INSSASGMYERLIYNENLSNNIMFELFKKDTQDYSDLEEQLIEKFINYVVSNVKKESRSN
                    ************************************************************

    COL             TLIELSKILENGYTIDKEEFKKEDDYLSKYIFTDIDYLKKLESKINVAIDIRSGEIHLVL
    NCTC8325        TLIELSKILENGYTIDKEEFKKEDDYLSKYIFTDIDYLKKLESKINVAIDIRSGEIHLVL
    Newman          TLIELSKILENGYTIDKEEFKKEDDYLSKYIFTDIDYLKKLESKINVAIDIRSGEIHLVL
    USA300_FPR3757  TLIELSKILENGYTIDKEEFKKEDDYLSKYIFTDIDYLKKLESKINVAIDIRSGEIHLVL
                    ************************************************************

    COL             DDDSLDILIQNQKYGNEF
    NCTC8325        DDDSLDILIQNQKYGNEF
    Newman          DDDSLDILIQNQKYGNEF
    USA300_FPR3757  DDDSLDILIQNQKYGNEF
                    ******************