From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005508000
  • symbol?: cdaA
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • ABC transporter, permease protein YbbP clustered with maltose/maltodextrin transporter / Tlr1762 protein
    • checkpoint controller nucleotide-binding protein
    • disA bacterial checkpoint controller nucleotide-binding family protein
    • membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 5673094..5673729
  • synteny block?: BlockID0042900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2102
    08BA02176:
    C248_2191
    11819-97:
    MS7_2178
    71193:
    ST398NM01_2218
    ECT-R 2:
    ECTR2_2016
    ED133:
    SAOV_2202c
    ED98:
    SAAV_2217
    HO 5096 0412:
    SAEMRSA15_20690
    JH1:
    SaurJH1_2233
    JH9:
    SaurJH9_2195
    JKD6008:
    SAA6008_02200 (disA)
    JKD6159:
    SAA6159_02072 (disA)
    LGA251:
    SARLGA251_19590
    M013:
    M013TW_2121
    MRSA252:
    SAR2254
    MSHR1132:
    SAMSHR1132_19950
    MSSA476:
    SAS2065
    Mu3:
    SAHV_2147
    Mu50:
    SAV2163
    MW2:
    MW2090
    RF122:
    SAB2043c
    ST398:
    SAPIG2218
    T0131:
    SAT0131_02328
    TCH60:
    HMPREF0772_11029
    TW20:
    SATW20_22980
    USA300_TCH1516:
    USA300HOU_2153
    VC40:
    SAVC_09680

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMI
    N315            MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMI
    NCTC8325        MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMI
    Newman          MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMI
    USA300_FPR3757  MDFSNFFQNLSTLKIVTSILDLLIVWYVLYLLITVFKGTKAIQLLKGILVIVIGQQISMI
                    ************************************************************

    COL             LNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQS
    N315            LNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQS
    NCTC8325        LNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQS
    Newman          LNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQS
    USA300_FPR3757  LNLTATSKLFDIVIQWGVLALIVIFQPEIRRALEQLGRGSFLKRYTSNTYSKDEEKLIQS
                    ************************************************************

    COL             VSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMI
    N315            VSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMI
    NCTC8325        VSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMI
    Newman          VSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMI
    USA300_FPR3757  VSKAVQYMAKRRIGALIVFEKETGLQDYIETGIAMDSNISQELLINVFIPNTPLHDGAMI
                    ************************************************************

    COL             IQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGK
    N315            IQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGK
    NCTC8325        IQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGK
    Newman          IQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGK
    USA300_FPR3757  IQGTKIAAAASYLPLSDSPKISKSLGTRHRAAVGISEVSDAFTVIVSEETGDISVTFDGK
                    ************************************************************

    COL             LRRDISNEIFEELLAEHWFGTRFQKKGVK
    N315            LRRDISNEIFEELLAEHWFGTRFQKKGVK
    NCTC8325        LRRDISNEIFEELLAEHWFGTRFQKKGVK
    Newman          LRRDISNEIFEELLAEHWFGTRFQKKGVK
    USA300_FPR3757  LRRDISNEIFEELLAEHWFGTRFQKKGVK
                    *****************************