From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005557000
  • symbol?: sdrM
  • description?: major facilitator transporter

      descriptions from strain specific annotations:

    • major facilitator transporter
    • drug transporter, putative
    • Multidrug resistance protein B
    • major facilitator superfamily protein
    • putative drug transporter
    • putative transport protein
    • major facilitator superfamily transporter
    • Major facilitator superfamily MFS_1
    • drug resistance-involved transporter
    • MFS family major facilitator transporter
    • Permease
  • strand?: -
  • coordinates?: 5699917..5701260
  • synteny block?: BlockID0043180
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2107
    08BA02176:
    C248_2205
    11819-97:
    MS7_2192
    71193:
    ST398NM01_2229
    ECT-R 2:
    ECTR2_2030
    ED133:
    SAOV_2216c
    ED98:
    SAAV_2230
    HO 5096 0412:
    SAEMRSA15_20740
    JH1:
    SaurJH1_2238
    JH9:
    SaurJH9_2200
    JKD6008:
    SAA6008_02207
    JKD6159:
    SAA6159_02080
    LGA251:
    SARLGA251_19640
    M013:
    M013TW_2135
    MRSA252:
    SAR2260
    MSHR1132:
    SAMSHR1132_20010
    MSSA476:
    SAS2070
    Mu3:
    Mu50:
    MW2:
    MW2095
    RF122:
    SAB2050c
    ST398:
    SAPIG2229
    T0131:
    SAT0131_02337
    TCH60:
    HMPREF0772_11023
    TW20:
    SATW20_23040
    USA300_TCH1516:
    USA300HOU_2160
    VC40:
    SAVC_09715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLKSIITVIALILIMFMSAIESSIISLALPTIKQDLNAGNLISLIFTAYFIALVIANPI
    N315            MRLKSIITVIALILIMFMSAIESSIISLALPTIKQDLNAGNLISLIFTAYFIALVIANPI
    NCTC8325        MRLKSIITVIALILIMFMSAIESSIISLALPTIKQDLNAGNLISLIFTAYFIALVIANPI
    Newman          MRLKSIITVIALILIMFMSAIESSIISLALPTIKQDLNAGNLISLIFTAYFIALVIANPI
    USA300_FPR3757  MRLKSIITVIALILIMFMSAIESSIISLALPTIKQDLNAGNLISLIFTAYFIALVIANPI
                    ************************************************************

    COL             VGELLSRFKIIYVAIAGLLLFSIGSFMCGLSTNFTMLIISRVIQGFGSGVLMSLSQIVPK
    N315            VGELLSRFKIIYVAIAGLLLFSIGSFMCGLSTNFTMLIISRVIQGFGSGVLMSLSQIVPK
    NCTC8325        VGELLSRFKIIYVAIAGLLLFSIGSFMCGLSTNFTMLIISRVIQGFGSGVLMSLSQIVPK
    Newman          VGELLSRFKIIYVAIAGLLLFSIGSFMCGLSTNFTMLIISRVIQGFGSGVLMSLSQIVPK
    USA300_FPR3757  VGELLSRFKIIYVAIAGLLLFSIGSFMCGLSTNFTMLIISRVIQGFGSGVLMSLSQIVPK
                    ************************************************************

    COL             LAFEIPLRYKIMGIVGSVWGISSIIGPLLGGGILEFATWHWLFYINIPIAIIAIILVIWT
    N315            LAFEIPLRYKIMGIVGSVWGISSIIGPLLGGGILEFATWHWLFYINIPIAIIAIILVIWT
    NCTC8325        LAFEIPLRYKIMGIVGSVWGISSIIGPLLGGGILEFATWHWLFYINIPIAIIAIILVIWT
    Newman          LAFEIPLRYKIMGIVGSVWGISSIIGPLLGGGILEFATWHWLFYINIPIAIIAIILVIWT
    USA300_FPR3757  LAFEIPLRYKIMGIVGSVWGISSIIGPLLGGGILEFATWHWLFYINIPIAIIAIILVIWT
                    ************************************************************

    COL             FHFPEEETVAKSKFDTKGLTLFYVFIGLIMFALLNQQLLLLNFLSFILAIVVAMCLFKVE
    N315            FHFPEEETVAKSKFDTKGLTLFYVFIGLIMFALLNQQLLLLNFLSFILAIVVAMCLFKVE
    NCTC8325        FHFPEEETVAKSKFDTKGLTLFYVFIGLIMFALLNQQLLLLNFLSFILAIVVAMCLFKVE
    Newman          FHFPEEETVAKSKFDTKGLTLFYVFIGLIMFALLNQQLLLLNFLSFILAIVVAMCLFKVE
    USA300_FPR3757  FHFPEEETVAKSKFDTKGLTLFYVFIGLIMFALLNQQLLLLNFLSFILAIVVAMCLFKVE
                    ************************************************************

    COL             KHVSSPFLPVVEFNRSITLVFITDLLTAICLMGFNLYIPVYLQEQLGLSPLQSGLVIFPL
    N315            KHVSSPFLPVVEFNRSITLVFITDLLTAICLMGFNLYIPVYLQEQLGLSPLQSGLVIFPL
    NCTC8325        KHVSSPFLPVVEFNRSITLVFITDLLTAICLMGFNLYIPVYLQEQLGLSPLQSGLVIFPL
    Newman          KHVSSPFLPVVEFNRSITLVFITDLLTAICLMGFNLYIPVYLQEQLGLSPLQSGLVIFPL
    USA300_FPR3757  KHVSSPFLPVVEFNRSITLVFITDLLTAICLMGFNLYIPVYLQEQLGLSPLQSGLVIFPL
                    ************************************************************

    COL             SVAWITLNFNLHRIEAKLSRKVIYLLSFTLLLVSSIIISFGIKLPVLIAFVLILAGLSFG
    N315            SVAWITLNFNLHRIEAKLSRKVIYLLSFTLLLVSSIIISFGIKLPVLIAFVLILAGLSFG
    NCTC8325        SVAWITLNFNLHRIEAKLSRKVIYLLSFTLLLVSSIIISFGIKLPVLIAFVLILAGLSFG
    Newman          SVAWITLNFNLHRIEAKLSRKVIYLLSFTLLLVSSIIISFGIKLPVLIAFVLILAGLSFG
    USA300_FPR3757  SVAWITLNFNLHRIEAKLSRKVIYLLSFTLLLVSSIIISFGIKLPVLIAFVLILAGLSFG
                    ************************************************************

    COL             YIYTKDSVIVQEETSPLQMKKMMSFYGLTKNLGASIGSTIMGYLYAIQSGIFGPNLHNVL
    N315            YIYTKDSVIVQEETSPLQMKKMMSFYGLTKNLGASIGSTIMGYLYAIQSGIFGPNLHNVL
    NCTC8325        YIYTKDSVIVQEETSPLQMKKMMSFYGLTKNLGASIGSTIMGYLYAIQSGIFGPNLHNVL
    Newman          YIYTKDSVIVQEETSPLQMKKMMSFYGLTKNLGASIGSTIMGYLYAIQSGIFGPNLHNVL
    USA300_FPR3757  YIYTKDSVIVQEETSPLQMKKMMSFYGLTKNLGASIGSTIMGYLYAIQSGIFGPNLHNVL
                    ************************************************************

    COL             SAVAVISIGLIVLWVVFFKEQSSQSKE
    N315            SAVAVISIGLIVLWVVFFKEQSSQSKE
    NCTC8325        SAVAVISIGLIVLWVVFFKEQSSQSKE
    Newman          SAVAVISIGLIVLWVVFFKEQSSQSKE
    USA300_FPR3757  SAVAVISIGLIVLWVVFFKEQSSQSKE
                    ***************************