Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005566000
  • symbol?: htsB
  • description?: heme transport system permease

      descriptions from strain specific annotations:

    • heme transport system permease
    • iron compound ABC transporter, permease protein
    • Heme ABC type transporter HtsABC, permease protein HtsB
    • fecCD transport family protein
    • ferrichrome ABC transporter permease
    • iron compound ABC transporter permease
    • iron (Fe3+) ABC transporter membrane protein
    • iron transport family protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
  • strand?: -
  • coordinates?: 5707210..5708127
  • synteny block?: BlockID0043260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2114 (htsB)
    08BA02176:
    C248_2213
    11819-97:
    MS7_2199
    71193:
    ST398NM01_2236
    ECT-R 2:
    ECTR2_2037
    ED133:
    SAOV_2223c
    ED98:
    SAAV_2237
    HO 5096 0412:
    SAEMRSA15_20810
    JH1:
    SaurJH1_2245
    JH9:
    SaurJH9_2207
    JKD6008:
    SAA6008_02214
    JKD6159:
    SAA6159_02087
    LGA251:
    SARLGA251_19710
    M013:
    M013TW_2142
    MRSA252:
    SAR2267
    MSHR1132:
    SAMSHR1132_20080
    MSSA476:
    SAS2077
    Mu3:
    SAHV_2160
    Mu50:
    SAV2176 (htsB)
    MW2:
    MW2102
    RF122:
    SAB2057c
    ST398:
    SAPIG2236
    T0131:
    SAT0131_02345
    TCH60:
    HMPREF0772_11016
    TW20:
    SATW20_23110
    USA300_TCH1516:
    USA300HOU_2168
    VC40:
    SAVC_09750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIKEISSQSAIDHKRKRRTTLTYIVSLCFLFICIYLNMAIGSSKINFSDIIHYVTGHTD
    N315            MAIKEISSQSAIDHKRKRRTTLTYIVSLCFLFICIYLNMAIGSSKINFSDIIHYVTGHTD
    NCTC8325        MAIKEISSQSAIDHKRKRRTTLTYIVSLCFLFICIYLNMAIGSSKINFSDIIHYVTGHTD
    Newman          MAIKEISSQSAIDHKRKRRTTLTYIVSLCFLFICIYLNMAIGSSKINFSDIIHYVTGHTD
    USA300_FPR3757  MAIKEISSQSAIDHKRKRRTTLTYIVSLCFLFICIYLNMAIGSSKINFSDIIHYVTGHTD
                    ************************************************************

    COL             TKATFLLHNVRMPRMIAGLFIGGALAVSGLLMQAMTRNPLASPKIFGVSSGASFFIVFVT
    N315            TKATFLLHNVRMPRMIAGLFIGGALAVSGLLMQAMTRNPLASPKIFGVSSGASFFIVFVT
    NCTC8325        TKATFLLHNVRMPRMIAGLFIGGALAVSGLLMQAMTRNPLASPKIFGVSSGASFFIVFVT
    Newman          TKATFLLHNVRMPRMIAGLFIGGALAVSGLLMQAMTRNPLASPKIFGVSSGASFFIVFVT
    USA300_FPR3757  TKATFLLHNVRMPRMIAGLFIGGALAVSGLLMQAMTRNPLASPKIFGVSSGASFFIVFVT
                    ************************************************************

    COL             IIIPALEYYALYLGVIGAFIGGLTVYTLSGATKGMTPIKLALAGMAIHLFFSSMTEGIII
    N315            IIIPSLEYYALYLGVIGAFIGGLTVYTLSGATKGMTPIKLALAGMAIHLFFSSMTEGIII
    NCTC8325        IIIPALEYYALYLGVIGAFIGGLTVYTLSGATKGMTPIKLALAGMAIHLFFSSMTEGIII
    Newman          IIIPALEYYALYLGVIGAFIGGLTVYTLSGATKGMTPIKLALAGMAIHLFFSSMTEGIII
    USA300_FPR3757  IIIPALEYYALYLGVIGAFIGGLTVYTLSGATKGMTPIKLALAGMAIHLFFSSMTEGIII
                    ****:*******************************************************

    COL             LNENSNEQVMFWLVGSLSSMKWDEILTILPWIIGALIVTIFIGRQLTIMELGDDIAKGLG
    N315            LNENSNEQVMFWLVGSLSSMKWDEILTILPWIIGALIVTIFIGRQLTIMELGDDIAKGLG
    NCTC8325        LNENSNEQVMFWLVGSLSSMKWDEILTILPWIIGALIVTIFIGRQLTIMELGDDIAKGLG
    Newman          LNENSNEQVMFWLVGSLSSMKWDEILTILPWIIGALIVTIFIGRQLTIMELGDDIAKGLG
    USA300_FPR3757  LNENSNEQVMFWLVGSLSSMKWDEILTILPWIIGALIVTIFIGRQLTIMELGDDIAKGLG
                    ************************************************************

    COL             QNINKVRIIIGLLVIILTGMSVSVAGPIGFVGLIVPHIVKRYVSKNYLVMIPLTFIIGAD
    N315            QNINKVRIIIGLLVIILTGMSVSVAGPIGFVGLIVPHIVKRYVSKNYLVMIPLTFIIGAD
    NCTC8325        QNINKVRIIIGLLVIILTGMSVSVAGPIGFVGLIVPHIVKRYVSKNYLVMIPLTFIIGAD
    Newman          QNINKVRIIIGLLVIILTGMSVSVAGPIGFVGLIVPHIVKRYVSKNYLVMIPLTFIIGAD
    USA300_FPR3757  QNINKVRIIIGLLVIILTGMSVSVAGPIGFVGLIVPHIVKRYVSKNYLVMIPLTFIIGAD
                    ************************************************************

    COL             LLLLSDVLSRLITYPYESPVGIVTSFVGALYFLFITIKGVKRI
    N315            LLLLSDVLSRLITYPYESPVGIVTSFVGALYFLFITIKGVKRI
    NCTC8325        LLLLSDVLSRLITYPYESPVGIVTSFVGALYFLFITIKGVKRI
    Newman          LLLLSDVLSRLITYPYESPVGIVTSFVGALYFLFITIKGVKRI
    USA300_FPR3757  LLLLSDVLSRLITYPYESPVGIVTSFVGALYFLFITIKGVKRI
                    *******************************************