From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005570000
  • symbol?:
  • description?: Siderophore biosynthesis protein

      descriptions from strain specific annotations:

    • Siderophore biosynthesis protein
    • iucA / IucC family protein
    • aerobactin biosynthesis protein
    • aerobactin biosynthesis protein, IucA/IucC family
    • putative siderophore biosynthesis protein
    • IucA/IucC family aerobactin biosynthesis protein
    • siderophore biosynthesis protein, IucA/IucC family
    • amino-acid citrate synthetase
  • strand?: -
  • coordinates?: 5711028..5712791
  • synteny block?: BlockID0043300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2117
    08BA02176:
    C248_2217
    11819-97:
    MS7_2202
    71193:
    ST398NM01_2239
    ECT-R 2:
    ECTR2_2040
    ED133:
    SAOV_2226c
    ED98:
    SAAV_2240
    HO 5096 0412:
    SAEMRSA15_20840
    JH1:
    SaurJH1_2249
    JH9:
    SaurJH9_2210
    JKD6008:
    SAA6008_02217
    JKD6159:
    SAA6159_02090
    LGA251:
    SARLGA251_19740
    M013:
    M013TW_2145
    MRSA252:
    SAR2270
    MSHR1132:
    SAMSHR1132_20110
    MSSA476:
    SAS2080
    Mu3:
    SAHV_2163
    Mu50:
    SAV2179
    MW2:
    MW2105
    RF122:
    SAB2060c
    ST398:
    SAPIG2239
    T0131:
    SAT0131_02348 (memD)
    TCH60:
    HMPREF0772_11012
    TW20:
    SATW20_23140
    USA300_TCH1516:
    USA300HOU_2171
    VC40:
    SAVC_09765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVYLEWAKADRNIQYRVINAIIKERIYPEQTFISQKGSLIEIQYHMHVLTIEVVRKSALE
    N315            MVYLEWAKADRNIQYRVINAIIKERIYPEQTFISQKGSLIEIQYHMHVLTIEVVRKSALE
    NCTC8325        MVYLEWAKADRNIQYRVINAIIKERIYPEQTFISQKGSLIEIQYHMHVLTIEVVRKSALE
    Newman          MVYLEWAKADRNIQYRVINAIIKERIYPEQTFISQKGSLIEIQYHMHVLTIEVVRKSALE
    USA300_FPR3757  MVYLEWAKADRNIQYRVINAIIKERIYPEQTFISQKGSLIEIQYHMHVLTIEVVRKSALE
                    ************************************************************

    COL             RYEFTGDITYLNKGETSLIITLEGLLDVLNHDFDIPISERLREELIHSRDSLVETYKQMS
    N315            RYEFTGDITYLNKGETSLIITLEGLLDVLNHDFDIPISERLREELIHSRDSLVETYKQMS
    NCTC8325        RYEFTGDITYLNKGETSLIITLEGLLDVLNHDFDIPISERLREELIHSRDSLVETYKQMS
    Newman          RYEFTGDITYLNKGETSLIITLEGLLDVLNHDFDIPISERLREELIHSRDSLVETYKQMS
    USA300_FPR3757  RYEFTGDITYLNKGETSLIITLEGLLDVLNHDFDIPISERLREELIHSRDSLVETYKQMS
                    ************************************************************

    COL             HRQTLISQSFKFSRLPQDINFFSWLQHVKDSDKTDDLTYSESLVPEGHPTHPLTKTKLPL
    N315            HRQTLISQSFKFSRLPQDINFFSWLQHVKDSDKTDDLTYSESLVPEGHPTHPLTKTKLPL
    NCTC8325        HRQTLISQSFKFSRLPQDINFFSWLQHVKDSDKTDDLTYSESLVPEGHPTHPLTKTKLPL
    Newman          HRQTLISQSFKFSRLPQDINFFSWLQHVKDSDKTDDLTYSESLVPEGHPTHPLTKTKLPL
    USA300_FPR3757  HRQTLISQSFKFSRLPQDINFFSWLQHVKDSDKTDDLTYSESLVPEGHPTHPLTKTKLPL
                    ************************************************************

    COL             TMEEVRAYAPEFEKEIPLQIMMIEKDHVVCTAMDGNDQFIIDEIIPEYYNQIRVFLKSLG
    N315            TMEEVRAYAPEFEKEIPLQIMMIEKDHVVCTAMDGNDQFIIDEIIPEYYNQIRVFLKSLG
    NCTC8325        TMEEVRAYAPEFEKEIPLQIMMIEKDHVVCTAMDGNDQFIIDEIIPEYYNQIRVFLKSLG
    Newman          TMEEVRAYAPEFEKEIPLQIMMIEKDHVVCTAMDGNDQFIIDEIIPEYYNQIRVFLKSLG
    USA300_FPR3757  TMEEVRAYAPEFEKEIPLQIMMIEKDHVVCTAMDGNDQFIIDEIIPEYYNQIRVFLKSLG
                    ************************************************************

    COL             LKSEDYRAILVHPWQYDHTIGKYFEAWIAKKILIPTPFTILSKATLSFRTMSLIDKPYHV
    N315            LKSEDYRAILVHPWQYDHTIGKYFEAWIAKKILIPTPFTILSKATLSFRTMSLIDKPYHV
    NCTC8325        LKSEDYRAILVHPWQYDHTIGKYFEAWIAKKILIPTPFTILSKATLSFRTMSLIDKPYHV
    Newman          LKSEDYRAILVHPWQYDHTIGKYFEAWIAKKILIPTPFTILSKATLSFRTMSLIDKPYHV
    USA300_FPR3757  LKSEDYRAILVHPWQYDHTIGKYFEAWIAKKILIPTPFTILSKATLSFRTMSLIDKPYHV
                    ************************************************************

    COL             KLPVDAQATSAVRTVSTVTTVDGPKLSYALQNMLNQYPGFKVAMEPFGEYANVDKDRARQ
    N315            KLPVDAQATSAVRTVSTVTTVDGPKLSYALQNMLNQYPGFKVAMEPFGEYANVDKDRARQ
    NCTC8325        KLPVDAQATSAVRTVSTVTTVDGPKLSYALQNMLNQYPGFKVAMEPFGEYANVDKDRARQ
    Newman          KLPVDAQATSAVRTVSTVTTVDGPKLSYALQNMLNQYPGFKVAMEPFGEYANVDKDRARQ
    USA300_FPR3757  KLPVDAQATSAVRTVSTVTTVDGPKLSYALQNMLNQYPGFKVAMEPFGEYANVDKDRARQ
                    ************************************************************

    COL             LACIIRQKPEIDGKGATVVSASLVNKNPIDQKVIVDSYLEWLNQGITKESITTFIERYAQ
    N315            LACIIRQKPEIDGKGATVVSASLVNKNPIDQKVIVDSYLEWLNQGITKESITTFIERYAQ
    NCTC8325        LACIIRQKPEIDGKGATVVSASLVNKNPIDQKVIVDSYLEWLNQGITKESITTFIERYAQ
    Newman          LACIIRQKPEIDGKGATVVSASLVNKNPIDQKVIVDSYLEWLNQGITKESITTFIERYAQ
    USA300_FPR3757  LACIIRQKPEIDGKGATVVSASLVNKNPIDQKVIVDSYLEWLNQGITKESITTFIERYAQ
                    ************************************************************

    COL             ALIPPLIAFIQNYGIALEAHMQNTVVNLGPHFDIQFLVRDLGGSRIDLETLQHRVSDIKI
    N315            ALIPPLIAFIQNYGIALEAHMQNTVVNLGPHFDIQFLVRDLGGSRIDLETLQHRVSDIKI
    NCTC8325        ALIPPLIAFIQNYGIALEAHMQNTVVNLGPHFDIQFLVRDLGGSRIDLETLQHRVSDIKI
    Newman          ALIPPLIAFIQNYGIALEAHMQNTVVNLGPHFDIQFLVRDLGGSRIDLETLQHRVSDIKI
    USA300_FPR3757  ALIPPLIAFIQNYGIALEAHMQNTVVNLGPHFDIQFLVRDLGGSRIDLETLQHRVSDIKI
                    ************************************************************

    COL             TNDSLIADSIDAVIAKFQHAVIQNQMAELIHHFNQYDCVEETELFNIVQQVVAHAINPTL
    N315            TNDSLIADSIDAVIAKFQHAVIQNQMAELIHHFNQYDCVEETELFNIVQQVVAHAINPTL
    NCTC8325        TNDSLIADSIDAVIAKFQHAVIQNQMAELIHHFNQYDCVEETELFNIVQQVVAHAINPTL
    Newman          TNDSLIADSIDAVIAKFQHAVIQNQMAELIHHFNQYDCVEETELFNIVQQVVAHAINPTL
    USA300_FPR3757  TNDSLIADSIDAVIAKFQHAVIQNQMAELIHHFNQYDCVEETELFNIVQQVVAHAINPTL
                    ************************************************************

    COL             PHANELKDILFGPTITVKALLNMRMENKVKQYLNIELDNPIKKEV
    N315            PHANELKDILFGPTITVKALLNMRMENKVKQYLNIELDNPIKKEV
    NCTC8325        PHANELKDILFGPTITVKALLNMRMENKVKQYLNIELDNPIKKEV
    Newman          PHANELKDILFGPTITVKALLNMRMENKVKQYLNIELDNPIKKEV
    USA300_FPR3757  PHANELKDILFGPTITVKALLNMRMENKVKQYLNIELDNPIKKEV
                    *********************************************