From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005582000
  • symbol?:
  • description?: zinc-binding alcohol dehydrogenase

      descriptions from strain specific annotations:

    • zinc-binding alcohol dehydrogenase
    • alcohol dehydrogenase, zinc-containing
    • alcohol dehydrogenase
    • Alcohol dehydrogenase zinc-binding type 1
    • Zinc-type alcohol dehydrogenase-like protein
    • alcohol dehydrogenase, zinc-binding domain protein
    • alginate lyase
    • Bifunctional protein: zinc-containing alcohol dehydrogenase
    • bifunctional protein : zinc-containing alcoholdehydrogenase, quinone oxidoreductase
    • putative zinc-binding dehydrogenase
    • quinone oxidoreductase ( NADPH:quinone reductase)
    • zinc-binding alcohol dehydrogenase family protein
  • strand?: -
  • coordinates?: 5721768..5722775
  • synteny block?: BlockID0043420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2124
    08BA02176:
    C248_2224
    11819-97:
    MS7_2209
    71193:
    ST398NM01_2246
    ECT-R 2:
    ECTR2_2047
    ED133:
    SAOV_2233c
    ED98:
    SAAV_2247
    HO 5096 0412:
    SAEMRSA15_20910
    JH1:
    SaurJH1_2256
    JH9:
    SaurJH9_2217
    JKD6008:
    SAA6008_02227
    JKD6159:
    SAA6159_02097
    LGA251:
    SARLGA251_19810
    M013:
    M013TW_2152
    MRSA252:
    SAR2277
    MSHR1132:
    SAMSHR1132_20180
    MSSA476:
    SAS2087
    Mu3:
    SAHV_2170
    Mu50:
    SAV2186
    MW2:
    MW2112
    RF122:
    SAB2067c
    ST398:
    SAPIG2246
    T0131:
    SAT0131_02359
    TCH60:
    HMPREF0772_11005
    TW20:
    SATW20_23240
    USA300_TCH1516:
    USA300HOU_2179
    VC40:
    SAVC_09820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKMIGFEKPFKLEEGNLFKVYEQRKPTPENDDILVKVNSISVNPVDTKQRQMEVTQAPRV
    N315            MKMIGFEKPFKLEEGNLFKVYEQRKPTPENDDILVKVNSISVNPVDTKQRQMKVTQAPRV
    NCTC8325        MKMIGFEKPFKLEEGNLFKVYEQRKPTPENDDILVKVNSISVNPVDTKQRQMEVTQAPRV
    Newman          MKMIGFEKPFKLEEGNLFKVYEQRKPTPENDDILVKVNSISVNPVDTKQRQMEVTQAPRV
    USA300_FPR3757  MKMIGFEKPFKLEEGNLFKVYEQRKPTPENDDILVKVNSISVNPVDTKQRQMEVTQAPRV
                    ****************************************************:*******

    COL             LGFDAIGTVEAIGPDVTLFSPGDVVFYAGSPNRQGSNATYQLVSEAIVAKAPHNISANEA
    N315            LGFDAIGTVEAIGPDVTLFSPGDVVFYAGSPNRQGSNATYQLVSEAIVAKAPHNISANEA
    NCTC8325        LGFDAIGTVEAIGPDVTLFSPGDVVFYAGSPNRQGSNATYQLVSEAIVAKAPHNISANEA
    Newman          LGFDAIGTVEAIGPDVTLFSPGDVVFYAGSPNRQGSNATYQLVSEAIVAKAPHNISANEA
    USA300_FPR3757  LGFDAIGTVEAIGPDVTLFSPGDVVFYAGSPNRQGSNATYQLVSEAIVAKAPHNISANEA
                    ************************************************************

    COL             VSLPLTGITAYETFFDTFKISTNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTA
    N315            VSLPLTGITAYETFFDTFKISHNPSENVGKSVLIINGAGGVGSIATQIAKRYGLTVITTA
    NCTC8325        VSLPLTGITAYETFFDTFKISTNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTA
    Newman          VSLPLTGITAYETFFDTFKISTNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTA
    USA300_FPR3757  VSLPLTGITAYETFFDTFKISTNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTA
                    ********************* **:** ********************************

    COL             SRQETTEWCEKMGADIVLNHKEDLVRQF--KEIPLVDYIFCTYNTDLYYNTMIELIKPLG
    N315            SRQETTEWCEKMGADIVLNHKEDLVRQFKEKEIPLVDYIFCTYNTDLYYNTMIELIKPLG
    NCTC8325        SRQETTEWCEKMGADIVLNHKEDLVRQF--KEIPLVDYIFCTYNTDLYYNTMIELIKPLG
    Newman          SRQETTEWCEKMGADIVLNHKEDLVRQF--KEIPLVDYIFCTYNTDLYYNTMIELIKPLG
    USA300_FPR3757  SRQETTEWCEKMGADIVLNHKEDLVRQF--KEIPLVDYIFCTYNTDLYYNTMIELIKPLG
                    ****************************  ******************************

    COL             HITTIVAFNEDQDLNALKLKSITFTHEFMFARPIHRTPDMIKQHEYLEDITKNIESGHYQ
    N315            HITTIVAFNEDQDLNALKLKSITFTHEFMFARPIHRTPDMIKQHEYLEDITKNIELGHYQ
    NCTC8325        HITTIVAFNEDQDLNALKLKSITFTHEFMFARPIHRTPDMIKQHEYLEDITKNIESGHYQ
    Newman          HITTIVAFNEDQDLNALKLKSITFTHEFMFARPIHRTPDMIKQHEYLEDITKNIESGHYQ
    USA300_FPR3757  HITTIVAFNEDQDLNALKLKSITFTHEFMFARPIHRTPDMIKQHEYLEDITKNIESGHYQ
                    ******************************************************* ****

    COL             PTTTQVFEGLSPENLYQAHQLLEKQSMIGKLVINI
    N315            PTTTQVFEGLSPENLYQAHQLLEKQSMIGKLVINI
    NCTC8325        PTTTQVFEGLSPENLYQAHQLLEKQSMIGKLVINI
    Newman          PTTTQVFEGLSPENLYQAHQLLEKQSMIGKLVINI
    USA300_FPR3757  PTTTQVFEGLSPENLYQAHQLLEKQSMIGKLVINI
                    ***********************************