From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005589000
  • symbol?: lacC
  • description?: tagatose-6-phosphate kinase

      descriptions from strain specific annotations:

    • tagatose-6-phosphate kinase
    • Tagatose-6-phosphate kinase / 1-phosphofructokinase
  • strand?: -
  • coordinates?: 5730270..5730747
  • synteny block?: BlockID0043490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2184 (lacC)
    N315:
    SA1995 (lacC)
    NCTC8325:
    Newman:
    NWMN_2097 (lacC)
    USA300_FPR3757:
    04-02981:
    SA2981_2131 (lacC)
    08BA02176:
    C248_2231 (lacC)
    11819-97:
    MS7_2216 (lacC)
    71193:
    ST398NM01_2253
    ECT-R 2:
    ECTR2_2054 (lacC)
    ED133:
    SAOV_2240c
    ED98:
    SAAV_2254 (lacC)
    HO 5096 0412:
    SAEMRSA15_20980 (lacC)
    JH1:
    SaurJH1_2263
    JH9:
    SaurJH9_2224
    JKD6008:
    SAA6008_02234 (lacC)
    JKD6159:
    SAA6159_02104 (lacC)
    LGA251:
    SARLGA251_19880 (lacC)
    M013:
    M013TW_2159
    MRSA252:
    SAR2284 (lacC)
    MSHR1132:
    SAMSHR1132_20250
    MSSA476:
    SAS2094
    Mu3:
    SAHV_2177 (lacC)
    Mu50:
    SAV2193 (lacC)
    MW2:
    MW2119 (lacC)
    RF122:
    SAB2074c (lacC)
    ST398:
    SAPIG2253 (lacC)
    T0131:
    SAT0131_02367
    TCH60:
    HMPREF0772_10998 (lacC)
    TW20:
    SATW20_23310 (lacC)
    USA300_TCH1516:
    USA300HOU_2186 (lacC)
    VC40:
    SAVC_09855 (lacC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIG
    N315            MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIG
    NCTC8325        MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIG
    Newman          MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIG
    USA300_FPR3757  MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIG
                    ************************************************************

    COL             GELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKH
    N315            GELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKH
    NCTC8325        GELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKH
    Newman          GELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKH
    USA300_FPR3757  GELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKH
                    ************************************************************

    COL             FEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPT
    N315            FEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPT
    NCTC8325        FEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPT
    Newman          FEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPT
    USA300_FPR3757  FEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPT
                    ************************************************************

    COL             VIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVN
    N315            VIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVN
    NCTC8325        VIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVN
    Newman          VIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVN
    USA300_FPR3757  VIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVN
                    ************************************************************

    COL             IPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDD
    N315            IPTINVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDE
    NCTC8325        IPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDD
    Newman          IPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDD
    USA300_FPR3757  IPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDD
                    ****.******************************************************:

    COL             LFNQIEVLEV
    N315            LFNQIEVLEV
    NCTC8325        LFNQIEVLEV
    Newman          LFNQIEVLEV
    USA300_FPR3757  LFNQIEVLEV
                    **********