From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005591000
  • symbol?: lacB
  • description?: galactose-6-phosphate isomerase subunit LacB

      descriptions from strain specific annotations:

    • galactose-6-phosphate isomerase subunit LacB
    • Galactose-6-phosphate isomerase, LacB subunit
    • galactose-6-phosphate isomerase LacB subunit
  • strand?: -
  • coordinates?: 5731215..5731730
  • synteny block?: BlockID0043510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2185 (lacB)
    N315:
    SA1996 (lacB)
    NCTC8325:
    Newman:
    NWMN_2098 (lacB)
    USA300_FPR3757:
    04-02981:
    SA2981_2132 (lacB)
    08BA02176:
    C248_2232 (lacB)
    11819-97:
    MS7_2217 (lacB)
    71193:
    ST398NM01_2254
    ECT-R 2:
    ECTR2_2055 (lacB)
    ED133:
    SAOV_2241c
    ED98:
    SAAV_2255 (lacB)
    HO 5096 0412:
    SAEMRSA15_20990 (lacB)
    JH1:
    SaurJH1_2264
    JH9:
    SaurJH9_2225
    JKD6008:
    SAA6008_02235 (lacB)
    JKD6159:
    SAA6159_02105 (lacB)
    LGA251:
    SARLGA251_19890 (lacB)
    M013:
    M013TW_2162
    MRSA252:
    SAR2285 (lacB)
    MSHR1132:
    SAMSHR1132_20260
    MSSA476:
    SAS2095
    Mu3:
    SAHV_2178 (lacB)
    Mu50:
    SAV2194 (lacB)
    MW2:
    MW2120 (lacB)
    RF122:
    SAB2075c (lacB)
    ST398:
    SAPIG2254 (lacB)
    T0131:
    SAT0131_02368
    TCH60:
    HMPREF0772_10997 (lacB)
    TW20:
    SATW20_23320 (lacB)
    USA300_TCH1516:
    USA300HOU_2187 (lacB)
    VC40:
    SAVC_09860 (lacB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADL
    N315            MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADL
    NCTC8325        MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADL
    Newman          MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADL
    USA300_FPR3757  MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADL
                    ************************************************************

    COL             GVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDII
    N315            GVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDII
    NCTC8325        GVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDII
    Newman          GVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDII
    USA300_FPR3757  GVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDII
                    ************************************************************

    COL             DAFINAEYKPTEENKKLIAKIKHLETSNADQADPHFFDEFLEKWDRGEYHD
    N315            DAFINAEYKATEENKKLIAKIKHLETSNADQADPHFFDEFLEKWDRGEYHD
    NCTC8325        DAFINAEYKPTEENKKLIAKIKHLETSNADQADPHFFDEFLEKWDRGEYHD
    Newman          DAFINAEYKPTEENKKLIAKIKHLETSNADQADPHFFDEFLEKWDRGEYHD
    USA300_FPR3757  DAFINAEYKPTEENKKLIAKIKHLETSNADQADPHFFDEFLEKWDRGEYHD
                    *********.*****************************************