From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005634000
  • symbol?: rpsI
  • description?: 30S ribosomal protein S9

      descriptions from strain specific annotations:

    • 30S ribosomal protein S9
    • 30S ribosomal protein S9 (BS10)
  • strand?: -
  • coordinates?: 5765057..5791126
  • synteny block?: BlockID0043870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2206 (rpsI)
    N315:
    SA2016 (rpsI)
    NCTC8325:
    Newman:
    NWMN_2119 (rpsI)
    USA300_FPR3757:
    04-02981:
    SA2981_2155 (rpsI)
    08BA02176:
    C248_2253 (rpsI)
    11819-97:
    MS7_2237 (rpsI)
    71193:
    ST398NM01_2270
    ECT-R 2:
    ECTR2_2079
    ED133:
    SAOV_2255c
    ED98:
    SAAV_2278 (rpsI)
    HO 5096 0412:
    SAEMRSA15_21160 (rpsI)
    JH1:
    SaurJH1_2285 (rpsI)
    JH9:
    SaurJH9_2244 (rpsI)
    JKD6008:
    SAA6008_02254 (rpsI)
    JKD6159:
    SAA6159_02124 (rpsI)
    LGA251:
    SARLGA251_20030 (rpsI)
    M013:
    M013TW_2177
    MRSA252:
    SAR2300 (rpsI)
    MSHR1132:
    SAMSHR1132_20430
    MSSA476:
    SAS2108 (rpsI)
    Mu3:
    SAHV_2201 (rpsI)
    Mu50:
    SAV2217 (rpsI)
    MW2:
    MW2136 (rpsI)
    RF122:
    SAB2090c (rpsI)
    ST398:
    SAPIG2270 (rpsI)
    T0131:
    SAT0131_02389
    TCH60:
    HMPREF0772_10981 (rpsI)
    TW20:
    SATW20_23510 (rpsI)
    USA300_TCH1516:
    USA300HOU_2208 (rpsI)
    VC40:
    SAVC_09955 (rpsI)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETK
    N315            --MAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETK
    NCTC8325        MTLAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETK
    Newman          --MAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETK
    USA300_FPR3757  MTLAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETK
                      :*********************************************************

    COL             GNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGL
    N315            GNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGL
    NCTC8325        GNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGL
    Newman          GNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGL
    USA300_FPR3757  GNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGL
                    ************************************************************

    COL             KAARRSPQFSKR
    N315            KAARRSPQFSKR
    NCTC8325        KAARRSPQFSKR
    Newman          KAARRSPQFSKR
    USA300_FPR3757  KAARRSPQFSKR
                    ************