From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005672000
  • symbol?: cbiO
  • description?: cobalt transporter ATP-binding subunit

      descriptions from strain specific annotations:

    • cobalt transporter ATP-binding subunit
    • ATPase component of general energizing module of ECF transporters
    • recF/RecN/SMC N terminal domain protein
    • cobalt import ATP-binding protein CbiO 2
    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter family protein
    • ATP-binding ABC transporter
  • strand?: -
  • coordinates?: 5794284..5795093
  • synteny block?: BlockID0044190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2211 (cbiO)
    N315:
    SA2021 (cbiO)
    NCTC8325:
    Newman:
    NWMN_2124 (cbiO)
    USA300_FPR3757:
    04-02981:
    SA2981_2160
    08BA02176:
    C248_2258
    11819-97:
    MS7_2242
    71193:
    ST398NM01_2275
    ECT-R 2:
    ECTR2_2084
    ED133:
    SAOV_2260c
    ED98:
    SAAV_2284
    HO 5096 0412:
    SAEMRSA15_21210
    JH1:
    SaurJH1_2290 (cbiO)
    JH9:
    SaurJH9_2249 (cbiO)
    JKD6008:
    SAA6008_02259 (cbiO)
    JKD6159:
    SAA6159_02129 (cbiO)
    LGA251:
    SARLGA251_20080
    M013:
    M013TW_2182
    MRSA252:
    SAR2305 (cbiO)
    MSHR1132:
    SAMSHR1132_20480
    MSSA476:
    SAS2113 (cbiO)
    Mu3:
    SAHV_2206 (cbiO)
    Mu50:
    SAV2222 (cbiO)
    MW2:
    MW2141 (cbiO)
    RF122:
    SAB2095c (cbiO)
    ST398:
    SAPIG2275
    T0131:
    SAT0131_02395
    TCH60:
    HMPREF0772_10976
    TW20:
    SATW20_23560
    USA300_TCH1516:
    USA300HOU_2213 (cbiO)
    VC40:
    SAVC_09980 (cbiO)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEDKNSVIVFKNVSFQYQSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEK
    N315            MEDKNSVIVFKNVSFQYQSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEK
    NCTC8325        MEDKNSVIVFKNVSFQYQSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEK
    Newman          MEDKNSVIVFKNVSFQYQSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEK
    USA300_FPR3757  MEDKNSVIVFKNVSFQYQSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEK
                    ************************************************************

    COL             VKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPYDEMH
    N315            VKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPHDEMH
    NCTC8325        VKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPYDEMH
    Newman          VKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPYDEMH
    USA300_FPR3757  VKSGEIFYNNQAITDDNFEKLRKDIGIVFQNPDNQFVGSIVKYDVAFGLENHAVPYDEMH
                    *******************************************************:****

    COL             RRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQN
    N315            RRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQN
    NCTC8325        RRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQN
    Newman          RRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQN
    USA300_FPR3757  RRVSEALKQVDMLERADYEPNALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQN
                    ************************************************************

    COL             LLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTATEIFDNAEELTRIG
    N315            LLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTATEIFDHAEELTRIG
    NCTC8325        LLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTATEIFDNAEELTRIG
    Newman          LLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTATEIFDNAEELTRIG
    USA300_FPR3757  LLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTATEIFDNAEELTRIG
                    ***************************************************:********

    COL             LDLPFPIKINQMLGHQTSFLTYEGLVDQL
    N315            LDLPFPIKINQMLGHQTSFLTYEGLVDQL
    NCTC8325        LDLPFPIKINQMLGHQTSFLTYEGLVDQL
    Newman          LDLPFPIKINQMLGHQTSFLTYEGLVDQL
    USA300_FPR3757  LDLPFPIKINQMLGHQTSFLTYEGLVDQL
                    *****************************