Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005684000
  • symbol?: rpmD
  • description?: 50S ribosomal protein L30

      descriptions from strain specific annotations:

    • 50S ribosomal protein L30
    • 50S ribosomal protein L30p (L7e)
  • strand?: -
  • coordinates?: 5802625..5802804
  • synteny block?: BlockID0044300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2221 (rpmD)
    N315:
    SA2030 (rpmD)
    NCTC8325:
    Newman:
    NWMN_2134 (rpmD)
    USA300_FPR3757:
    04-02981:
    SA2981_2170 (rpmD)
    08BA02176:
    C248_2268 (rpmD)
    11819-97:
    MS7_2252 (rpmD)
    71193:
    ST398NM01_2285
    ECT-R 2:
    ECTR2_2094 (rpmD)
    ED133:
    SAOV_2269c
    ED98:
    SAAV_2294 (rpmD)
    HO 5096 0412:
    SAEMRSA15_21310 (rpmD)
    JH1:
    SaurJH1_2300 (rpmD)
    JH9:
    SaurJH9_2259 (rpmD)
    JKD6008:
    SAA6008_02269 (rpmD)
    JKD6159:
    SAA6159_02139 (rpmD)
    LGA251:
    SARLGA251_20180 (rpmD)
    M013:
    M013TW_2192
    MRSA252:
    SAR2317 (rpmD)
    MSHR1132:
    SAMSHR1132_20580
    MSSA476:
    SAS2123 (rpmD)
    Mu3:
    SAHV_2216 (rpmD)
    Mu50:
    SAV2232 (rpmD)
    MW2:
    MW2151 (rpmD)
    RF122:
    SAB2104c (rpmD)
    ST398:
    SAPIG2285 (rpmD)
    T0131:
    SAT0131_02405
    TCH60:
    HMPREF0772_10966 (rpmD)
    TW20:
    SATW20_23660 (rpmD)
    USA300_TCH1516:
    USA300HOU_2223 (rpmD)
    VC40:
    SAVC_10030 (rpmD)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
    N315            MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
    NCTC8325        MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
    Newman          MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
    USA300_FPR3757  MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
                    ***********************************************************